Details of the Target

General Information of Target

Target ID LDTP02018
Target Name Major prion protein (PRNP)
Gene Name PRNP
Gene ID 5621
Synonyms
ALTPRP; PRIP; PRP; Major prion protein; PrP; ASCR; PrP27-30; PrP33-35C; CD antigen CD230
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP
HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA
VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV
NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV
ILLISFLIFLIVG
Target Type
Literature-reported
Target Bioclass
Transporter and channel
Family
Prion family
Subcellular location
Cell membrane
Function
Its primary physiological function is unclear. May play a role in neuronal development and synaptic plasticity. May be required for neuronal myelin sheath maintenance. May promote myelin homeostasis through acting as an agonist for ADGRG6 receptor. May play a role in iron uptake and iron homeostasis. Soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro). Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. Also provides Cu(2+) or Zn(2+) for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains.
TTD ID
T08722
Uniprot ID
P04156
DrugMap ID
TTY5F9C
Ensemble ID
ENST00000379440.9
HGNC ID
HGNC:9449
ChEMBL ID
CHEMBL4869

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
COLO320 SNV: p.A115G .
HT SNV: p.E152G .
RPMI8226 SNV: p.E196G .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
BTD
 Probe Info  		C214(0.98)  LDD2107  [1]
Jackson_14
 Probe Info  		2.00  LDD0123  [2]
DBIA
 Probe Info  		C214(0.96)  LDD1509  [3]
m-APA
 Probe Info  		N.A.  LDD2231  [4]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [5]
IA-alkyne
 Probe Info  		N.A.  LDD0162  [6]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [5]
NAIA_5
 Probe Info  		N.A.  LDD2223  [7]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0226  AC11 HEK-293T C214(0.96)  LDD1509  [3]
 LDCM0278  AC19 HEK-293T C214(0.97)  LDD1517  [3]
 LDCM0284  AC24 HEK-293T C179(1.04)  LDD1523  [3]
 LDCM0287  AC27 HEK-293T C214(0.90)  LDD1526  [3]
 LDCM0290  AC3 HEK-293T C214(1.03)  LDD1529  [3]
 LDCM0293  AC32 HEK-293T C179(0.93)  LDD1532  [3]
 LDCM0296  AC35 HEK-293T C214(0.90)  LDD1535  [3]
 LDCM0302  AC40 HEK-293T C179(0.84)  LDD1541  [3]
 LDCM0305  AC43 HEK-293T C214(0.96)  LDD1544  [3]
 LDCM0310  AC48 HEK-293T C179(0.84)  LDD1549  [3]
 LDCM0314  AC51 HEK-293T C214(1.00)  LDD1553  [3]
 LDCM0319  AC56 HEK-293T C179(0.88)  LDD1558  [3]
 LDCM0322  AC59 HEK-293T C214(0.94)  LDD1561  [3]
 LDCM0328  AC64 HEK-293T C179(0.99)  LDD1567  [3]
 LDCM0345  AC8 HEK-293T C179(1.07)  LDD1569  [3]
 LDCM0275  AKOS034007705 HEK-293T C179(0.86)  LDD1514  [3]
 LDCM0371  CL102 HEK-293T C214(0.93)  LDD1575  [3]
 LDCM0375  CL106 HEK-293T C214(0.80)  LDD1579  [3]
 LDCM0380  CL110 HEK-293T C214(0.93)  LDD1584  [3]
 LDCM0384  CL114 HEK-293T C214(0.89)  LDD1588  [3]
 LDCM0388  CL118 HEK-293T C214(0.74)  LDD1592  [3]
 LDCM0390  CL12 HEK-293T C179(1.19)  LDD1594  [3]
 LDCM0393  CL122 HEK-293T C214(1.03)  LDD1597  [3]
 LDCM0397  CL126 HEK-293T C214(1.20)  LDD1601  [3]
 LDCM0401  CL14 HEK-293T C214(1.12)  LDD1605  [3]
 LDCM0406  CL19 HEK-293T C214(0.86)  LDD1610  [3]
 LDCM0407  CL2 HEK-293T C214(1.00)  LDD1611  [3]
 LDCM0412  CL24 HEK-293T C179(1.23)  LDD1616  [3]
 LDCM0414  CL26 HEK-293T C214(0.90)  LDD1618  [3]
 LDCM0420  CL31 HEK-293T C214(1.07)  LDD1624  [3]
 LDCM0425  CL36 HEK-293T C179(1.31)  LDD1629  [3]
 LDCM0433  CL43 HEK-293T C214(0.88)  LDD1637  [3]
 LDCM0438  CL48 HEK-293T C179(1.41)  LDD1642  [3]
 LDCM0441  CL50 HEK-293T C214(0.99)  LDD1645  [3]
 LDCM0446  CL55 HEK-293T C214(0.95)  LDD1649  [3]
 LDCM0452  CL60 HEK-293T C179(1.13)  LDD1655  [3]
 LDCM0454  CL62 HEK-293T C214(0.93)  LDD1657  [3]
 LDCM0459  CL67 HEK-293T C214(0.98)  LDD1662  [3]
 LDCM0462  CL7 HEK-293T C214(0.94)  LDD1665  [3]
 LDCM0465  CL72 HEK-293T C179(1.21)  LDD1668  [3]
 LDCM0467  CL74 HEK-293T C214(0.98)  LDD1670  [3]
 LDCM0472  CL79 HEK-293T C214(0.99)  LDD1675  [3]
 LDCM0478  CL84 HEK-293T C179(1.15)  LDD1681  [3]
 LDCM0480  CL86 HEK-293T C214(1.19)  LDD1683  [3]
 LDCM0486  CL91 HEK-293T C214(0.87)  LDD1689  [3]
 LDCM0491  CL96 HEK-293T C179(1.11)  LDD1694  [3]
 LDCM0493  CL98 HEK-293T C214(1.08)  LDD1696  [3]
 LDCM0427  Fragment51 HEK-293T C214(0.86)  LDD1631  [3]
 LDCM0514  Nucleophilic fragment 20a MDA-MB-231 C214(0.98)  LDD2107  [1]
 LDCM0530  Nucleophilic fragment 28a MDA-MB-231 C214(0.84)  LDD2123  [1]
 LDCM0534  Nucleophilic fragment 30a MDA-MB-231 C214(1.72)  LDD2127  [1]
 LDCM0543  Nucleophilic fragment 38 MDA-MB-231 C214(1.21)  LDD2136  [1]
 LDCM0544  Nucleophilic fragment 39 MDA-MB-231 C214(1.02)  LDD2137  [1]
 LDCM0016  Ranjitkar_cp1 MDA-MB-231 2.00  LDD0123  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein argonaute-2 (AGO2) Argonaute family Q9UKV8
DNA-3-methyladenine glycosylase (MPG) DNA glycosylase MPG family P29372
Peroxiredoxin-1 (PRDX1) Peroxiredoxin family Q06830
Serine/threonine-protein kinase PLK3 (PLK3) Ser/Thr protein kinase family Q9H4B4
Atlastin-1 (ATL1) GB1/RHD3 GTPase family Q8WXF7
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Amyloid-beta precursor protein (APP) APP family P05067
Huntingtin (HTT) Huntingtin family P42858
Major prion protein (PRNP) Prion family P04156
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
GPCR
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Proteinase-activated receptor 2 (F2RL1) G-protein coupled receptor 1 family P55085
Frizzled-7 (FZD7) G-protein coupled receptor Fz/Smo family O75084
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc-alpha-2-glycoprotein (AZGP1) MHC class I family P25311
Other
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein argonaute-1 (AGO1) Argonaute family Q9UL18
Four and a half LIM domains protein 1 (FHL1) . Q13642
Microtubule-associated protein tau (MAPT) . P10636
Protein PIMREG (PIMREG) . Q9BSJ6

The Drug(s) Related To This Target

Approved
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Tetracycline Small molecular drug DB00759
Copper . DB09130

References

1 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
2 Appendage and Scaffold Diverse Fully Functionalized Small-Molecule Probes via a Minimalist Terminal Alkyne-Aliphatic Diazirine Isocyanide. J Org Chem. 2018 Sep 21;83(18):11245-11253. doi: 10.1021/acs.joc.8b01831. Epub 2018 Aug 31.
3 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
4 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
5 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
6 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
7 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264