General Information of Target

Target ID LDTP01832
Target Name Transforming growth factor beta-1 proprotein (TGFB1)
Gene Name TGFB1
Gene ID 7040
Synonyms
TGFB; Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide; LAP; Transforming growth factor beta-1; TGF-beta-1)]
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Target Type
Successful
Target Bioclass
Cytokine and receptor
Family
TGF-beta family
Subcellular location
Secreted; Secreted, extracellular space, extracellular matrix
Function
Transforming growth factor beta-1 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-1 (TGF-beta-1) chains, which constitute the regulatory and active subunit of TGF-beta-1, respectively.; [Latency-associated peptide]: Required to maintain the Transforming growth factor beta-1 (TGF-beta-1) chain in a latent state during storage in extracellular matrix. Associates non-covalently with TGF-beta-1 and regulates its activation via interaction with 'milieu molecules', such as LTBP1, LRRC32/GARP and LRRC33/NRROS, that control activation of TGF-beta-1 . Interaction with LRRC33/NRROS regulates activation of TGF-beta-1 in macrophages and microglia (Probable). Interaction with LRRC32/GARP controls activation of TGF-beta-1 on the surface of activated regulatory T-cells (Tregs). Interaction with integrins (ITGAV:ITGB6 or ITGAV:ITGB8) results in distortion of the Latency-associated peptide chain and subsequent release of the active TGF-beta-1.; [Transforming growth factor beta-1]: Multifunctional protein that regulates the growth and differentiation of various cell types and is involved in various processes, such as normal development, immune function, microglia function and responses to neurodegeneration. Activation into mature form follows different steps: following cleavage of the proprotein in the Golgi apparatus, Latency-associated peptide (LAP) and Transforming growth factor beta-1 (TGF-beta-1) chains remain non-covalently linked rendering TGF-beta-1 inactive during storage in extracellular matrix. At the same time, LAP chain interacts with 'milieu molecules', such as LTBP1, LRRC32/GARP and LRRC33/NRROS that control activation of TGF-beta-1 and maintain it in a latent state during storage in extracellular milieus . TGF-beta-1 is released from LAP by integrins (ITGAV:ITGB6 or ITGAV:ITGB8): integrin-binding to LAP stabilizes an alternative conformation of the LAP bowtie tail and results in distortion of the LAP chain and subsequent release of the active TGF-beta-1. Once activated following release of LAP, TGF-beta-1 acts by binding to TGF-beta receptors (TGFBR1 and TGFBR2), which transduce signal. While expressed by many cells types, TGF-beta-1 only has a very localized range of action within cell environment thanks to fine regulation of its activation by Latency-associated peptide chain (LAP) and 'milieu molecules'. Plays an important role in bone remodeling: acts as a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts. Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner. At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development. At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells. Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP). Mediates SMAD2/3 activation by inducing its phosphorylation and subsequent translocation to the nucleus. Positively regulates odontoblastic differentiation in dental papilla cells, via promotion of IPO7-mediated translocation of phosphorylated SMAD2 to the nucleus and subsequent transcription of target genes. Can induce epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types.
TTD ID
T97257
Uniprot ID
P01137
DrugMap ID
TT3A6MT
Ensemble ID
ENST00000221930.6
HGNC ID
HGNC:11766
ChEMBL ID
CHEMBL1795178

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info 
15.00  LDD0402  [1]
DBIA
 Probe Info 
C285(1.21)  LDD0078  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0216  AC100 HCT 116 C285(0.96)  LDD0533  [2]
 LDCM0217  AC101 HCT 116 C285(1.02)  LDD0534  [2]
 LDCM0218  AC102 HCT 116 C285(0.88)  LDD0535  [2]
 LDCM0219  AC103 HCT 116 C285(1.13)  LDD0536  [2]
 LDCM0220  AC104 HCT 116 C285(0.98)  LDD0537  [2]
 LDCM0221  AC105 HCT 116 C285(0.87)  LDD0538  [2]
 LDCM0222  AC106 HCT 116 C285(0.94)  LDD0539  [2]
 LDCM0223  AC107 HCT 116 C285(1.01)  LDD0540  [2]
 LDCM0224  AC108 HCT 116 C285(0.86)  LDD0541  [2]
 LDCM0225  AC109 HCT 116 C285(0.92)  LDD0542  [2]
 LDCM0227  AC110 HCT 116 C285(0.93)  LDD0544  [2]
 LDCM0228  AC111 HCT 116 C285(0.90)  LDD0545  [2]
 LDCM0229  AC112 HCT 116 C285(0.93)  LDD0546  [2]
 LDCM0285  AC25 HCT 116 C285(0.92)  LDD0602  [2]
 LDCM0286  AC26 HCT 116 C285(0.97)  LDD0603  [2]
 LDCM0287  AC27 HCT 116 C285(1.00)  LDD0604  [2]
 LDCM0288  AC28 HCT 116 C285(0.97)  LDD0605  [2]
 LDCM0289  AC29 HCT 116 C285(1.03)  LDD0606  [2]
 LDCM0291  AC30 HCT 116 C285(0.98)  LDD0608  [2]
 LDCM0292  AC31 HCT 116 C285(0.92)  LDD0609  [2]
 LDCM0293  AC32 HCT 116 C285(0.92)  LDD0610  [2]
 LDCM0294  AC33 HCT 116 C285(1.11)  LDD0611  [2]
 LDCM0295  AC34 HCT 116 C285(0.96)  LDD0612  [2]
 LDCM0296  AC35 HCT 116 C285(1.15)  LDD0613  [2]
 LDCM0297  AC36 HCT 116 C285(1.14)  LDD0614  [2]
 LDCM0298  AC37 HCT 116 C285(1.03)  LDD0615  [2]
 LDCM0299  AC38 HCT 116 C285(1.17)  LDD0616  [2]
 LDCM0300  AC39 HCT 116 C285(1.10)  LDD0617  [2]
 LDCM0302  AC40 HCT 116 C285(1.26)  LDD0619  [2]
 LDCM0303  AC41 HCT 116 C285(1.19)  LDD0620  [2]
 LDCM0304  AC42 HCT 116 C285(1.21)  LDD0621  [2]
 LDCM0305  AC43 HCT 116 C285(1.03)  LDD0622  [2]
 LDCM0306  AC44 HCT 116 C285(1.21)  LDD0623  [2]
 LDCM0307  AC45 HCT 116 C285(1.22)  LDD0624  [2]
 LDCM0308  AC46 HCT 116 C285(0.88)  LDD0625  [2]
 LDCM0309  AC47 HCT 116 C285(0.96)  LDD0626  [2]
 LDCM0310  AC48 HCT 116 C285(0.81)  LDD0627  [2]
 LDCM0311  AC49 HCT 116 C285(1.00)  LDD0628  [2]
 LDCM0313  AC50 HCT 116 C285(0.94)  LDD0630  [2]
 LDCM0314  AC51 HCT 116 C285(0.90)  LDD0631  [2]
 LDCM0315  AC52 HCT 116 C285(0.95)  LDD0632  [2]
 LDCM0316  AC53 HCT 116 C285(0.89)  LDD0633  [2]
 LDCM0317  AC54 HCT 116 C285(0.80)  LDD0634  [2]
 LDCM0318  AC55 HCT 116 C285(0.95)  LDD0635  [2]
 LDCM0319  AC56 HCT 116 C285(0.80)  LDD0636  [2]
 LDCM0332  AC68 HCT 116 C285(0.82)  LDD0649  [2]
 LDCM0333  AC69 HCT 116 C285(0.74)  LDD0650  [2]
 LDCM0335  AC70 HCT 116 C285(0.95)  LDD0652  [2]
 LDCM0336  AC71 HCT 116 C285(0.92)  LDD0653  [2]
 LDCM0337  AC72 HCT 116 C285(0.97)  LDD0654  [2]
 LDCM0338  AC73 HCT 116 C285(1.13)  LDD0655  [2]
 LDCM0339  AC74 HCT 116 C285(1.00)  LDD0656  [2]
 LDCM0340  AC75 HCT 116 C285(1.00)  LDD0657  [2]
 LDCM0341  AC76 HCT 116 C285(0.87)  LDD0658  [2]
 LDCM0342  AC77 HCT 116 C285(0.92)  LDD0659  [2]
 LDCM0343  AC78 HCT 116 C285(0.92)  LDD0660  [2]
 LDCM0344  AC79 HCT 116 C285(0.90)  LDD0661  [2]
 LDCM0346  AC80 HCT 116 C285(0.81)  LDD0663  [2]
 LDCM0347  AC81 HCT 116 C285(0.92)  LDD0664  [2]
 LDCM0348  AC82 HCT 116 C285(0.76)  LDD0665  [2]
 LDCM0365  AC98 HCT 116 C285(1.00)  LDD0682  [2]
 LDCM0366  AC99 HCT 116 C285(0.94)  LDD0683  [2]
 LDCM0156  Aniline NCI-H1299 11.76  LDD0403  [1]
 LDCM0020  ARS-1620 HCC44 C285(1.21)  LDD0078  [2]
 LDCM0382  CL112 HCT 116 C285(0.79)  LDD0699  [2]
 LDCM0383  CL113 HCT 116 C285(0.79)  LDD0700  [2]
 LDCM0384  CL114 HCT 116 C285(0.91)  LDD0701  [2]
 LDCM0385  CL115 HCT 116 C285(0.98)  LDD0702  [2]
 LDCM0386  CL116 HCT 116 C285(1.03)  LDD0703  [2]
 LDCM0387  CL117 HCT 116 C285(1.34)  LDD0704  [2]
 LDCM0388  CL118 HCT 116 C285(1.23)  LDD0705  [2]
 LDCM0389  CL119 HCT 116 C285(1.11)  LDD0706  [2]
 LDCM0391  CL120 HCT 116 C285(1.14)  LDD0708  [2]
 LDCM0392  CL121 HCT 116 C285(0.91)  LDD0709  [2]
 LDCM0393  CL122 HCT 116 C285(1.02)  LDD0710  [2]
 LDCM0394  CL123 HCT 116 C285(1.08)  LDD0711  [2]
 LDCM0395  CL124 HCT 116 C285(1.07)  LDD0712  [2]
 LDCM0022  KB02 EoL-1 C285(2.17)  LDD2324  [3]
 LDCM0023  KB03 EoL-1 C285(2.40)  LDD2741  [3]
 LDCM0024  KB05 EoL-1 C285(2.61)  LDD3158  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Disco-interacting protein 2 homolog A (DIP2A) DIP2 family Q14689
Protein disulfide-isomerase (P4HB) Protein disulfide isomerase family P07237
TGF-beta receptor type-1 (TGFBR1) TKL Ser/Thr protein kinase family P36897
TGF-beta receptor type-2 (TGFBR2) TKL Ser/Thr protein kinase family P37173
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Amyloid-beta precursor protein (APP) APP family P05067
Cation channel sperm-associated protein 1 (CATSPER1) Cation channel sperm-associated (TC 1.A.1.19) family Q8NEC5
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
POU domain, class 4, transcription factor 2 (POU4F2) POU transcription factor family Q12837
Homeobox protein MOX-2 (MEOX2) . P50222
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Pregnancy-specific beta-1-glycoprotein 1 (PSG1) CEA family P11464
Cytokine and receptor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Transforming growth factor beta-1 proprotein (TGFB1) TGF-beta family P01137
Endoglin (ENG) . P17813
Transforming growth factor beta receptor type 3 (TGFBR3) . Q03167
Other
Click To Hide/Show 17 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Keratin-associated protein 1-1 (KRTAP1-1) KRTAP type 1 family Q07627
Keratin-associated protein 1-3 (KRTAP1-3) KRTAP type 1 family Q8IUG1
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 4-11 (KRTAP4-11) KRTAP type 4 family Q9BYQ6
Late cornified envelope protein 1A (LCE1A) LCE family Q5T7P2
Late cornified envelope protein 1C (LCE1C) LCE family Q5T751
Late cornified envelope protein 1D (LCE1D) LCE family Q5T752
Late cornified envelope protein 2B (LCE2B) LCE family O14633
Late cornified envelope protein 2C (LCE2C) LCE family Q5TA81
Late cornified envelope protein 3A (LCE3A) LCE family Q5TA76
Late cornified envelope protein 3B (LCE3B) LCE family Q5TA77
Late cornified envelope protein 3D (LCE3D) LCE family Q9BYE3
Transforming growth factor beta activator LRRC32 (LRRC32) LRRC32/LRRC33 family Q14392
Leupaxin (LPXN) Paxillin family O60711
Thrombospondin-1 (THBS1) Thrombospondin family P07996
Follistatin-related protein 1 (FSTL1) . Q12841

The Drug(s) Related To This Target

Approved
Click To Hide/Show 6 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Hyaluronidase (Human Recombinant) BiotechDrug DB06205
Hyaluronidase (Ovine) BiotechDrug DB00070
Terazosin Small molecular drug DB01162
Foreskin Fibroblast (Neonatal) . DB10770
Foreskin Keratinocyte (Neonatal) . DB10772
Hyaluronidase . DB14740

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
3 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840