General Information of Target

Target ID LDTP00930
Target Name E3 ubiquitin-protein ligase parkin (PRKN)
Gene Name PRKN
Gene ID 5071
Synonyms
PARK2; E3 ubiquitin-protein ligase parkin; Parkin; EC 2.3.2.31; Parkin RBR E3 ubiquitin-protein ligase; Parkinson juvenile disease protein 2; Parkinson disease protein 2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD
LDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLA
VILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGP
SCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCIT
CTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKE
LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGC
GFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPR
CHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV
Target Bioclass
Enzyme
Family
RBR family, Parkin subfamily
Subcellular location
Cytoplasm, cytosol
Function
Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Substrates include SYT11 and VDAC1. Other substrates are BCL2, CCNE1, GPR37, RHOT1/MIRO1, MFN1, MFN2, STUB1, SNCAIP, SEPTIN5, TOMM20, USP30, ZNF746, MIRO1 and AIMP2 . Mediates monoubiquitination as well as 'Lys-6', 'Lys-11', 'Lys-48'-linked and 'Lys-63'-linked polyubiquitination of substrates depending on the context. Participates in the removal and/or detoxification of abnormally folded or damaged protein by mediating 'Lys-63'-linked polyubiquitination of misfolded proteins such as PARK7: 'Lys-63'-linked polyubiquitinated misfolded proteins are then recognized by HDAC6, leading to their recruitment to aggresomes, followed by degradation. Mediates 'Lys-63'-linked polyubiquitination of a 22 kDa O-linked glycosylated isoform of SNCAIP, possibly playing a role in Lewy-body formation. Mediates monoubiquitination of BCL2, thereby acting as a positive regulator of autophagy. Protects against mitochondrial dysfunction during cellular stress, by acting downstream of PINK1 to coordinate mitochondrial quality control mechanisms that remove and replace dysfunctional mitochondrial components. Depending on the severity of mitochondrial damage and/or dysfunction, activity ranges from preventing apoptosis and stimulating mitochondrial biogenesis to regulating mitochondrial dynamics and eliminating severely damaged mitochondria via mitophagy. Activation and recruitment onto the outer membrane of damaged/dysfunctional mitochondria (OMM) requires PINK1-mediated phosphorylation of both PRKN and ubiquitin. After mitochondrial damage, functions with PINK1 to mediate the decision between mitophagy or preventing apoptosis by inducing either the poly- or monoubiquitination of VDAC1, respectively; polyubiquitination of VDAC1 promotes mitophagy, while monoubiquitination of VDAC1 decreases mitochondrial calcium influx which ultimately inhibits apoptosis. When cellular stress results in irreversible mitochondrial damage, promotes the autophagic degradation of dysfunctional depolarized mitochondria (mitophagy) by promoting the ubiquitination of mitochondrial proteins such as TOMM20, RHOT1/MIRO1, MFN1 and USP30. Preferentially assembles 'Lys-6'-, 'Lys-11'- and 'Lys-63'-linked polyubiquitin chains, leading to mitophagy. The PINK1-PRKN pathway also promotes fission of damaged mitochondria by PINK1-mediated phosphorylation which promotes the PRKN-dependent degradation of mitochondrial proteins involved in fission such as MFN2. This prevents the refusion of unhealthy mitochondria with the mitochondrial network or initiates mitochondrial fragmentation facilitating their later engulfment by autophagosomes. Regulates motility of damaged mitochondria via the ubiquitination and subsequent degradation of MIRO1 and MIRO2; in motor neurons, this likely inhibits mitochondrial intracellular anterograde transport along the axons which probably increases the chance of the mitochondria undergoing mitophagy in the soma. Involved in mitochondrial biogenesis via the 'Lys-48'-linked polyubiquitination of transcriptional repressor ZNF746/PARIS which leads to its subsequent proteasomal degradation and allows activation of the transcription factor PPARGC1A. Limits the production of reactive oxygen species (ROS). Regulates cyclin-E during neuronal apoptosis. In collaboration with CHPF isoform 2, may enhance cell viability and protect cells from oxidative stress. Independently of its ubiquitin ligase activity, protects from apoptosis by the transcriptional repression of p53/TP53. May protect neurons against alpha synuclein toxicity, proteasomal dysfunction, GPR37 accumulation, and kainate-induced excitotoxicity. May play a role in controlling neurotransmitter trafficking at the presynaptic terminal and in calcium-dependent exocytosis. May represent a tumor suppressor gene.
Uniprot ID
O60260
Ensemble ID
ENST00000366896.5
HGNC ID
HGNC:8607

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
A3KAW SNV: p.N295K .
CALU6 Deletion: p.Q34RfsTer5 .
HCT116 SNV: p.I229F .
HT Deletion: p.G77VfsTer4 .
MELJUSO SNV: p.A406T .
MOLT4 SNV: p.A230T .
NALM6 SNV: p.P37Q .
NCIH1975 SNV: p.Q252H .
OVCAR8 Deletion: p.P113TfsTer51 .
RD SNV: p.S296F .
RH41 SNV: p.Q347H .
SKMEL24 SNV: p.A120V .
T98G Deletion: p.R392KfsTer40 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C95(1.85)  LDD3335  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0259  AC14 HEK-293T C95(1.28)  LDD1512  [2]
 LDCM0282  AC22 HEK-293T C95(0.96)  LDD1521  [2]
 LDCM0284  AC24 HEK-293T C95(1.39)  LDD1523  [2]
 LDCM0291  AC30 HEK-293T C95(0.98)  LDD1530  [2]
 LDCM0293  AC32 HEK-293T C95(1.35)  LDD1532  [2]
 LDCM0299  AC38 HEK-293T C95(0.99)  LDD1538  [2]
 LDCM0302  AC40 HEK-293T C95(1.13)  LDD1541  [2]
 LDCM0308  AC46 HEK-293T C95(1.09)  LDD1547  [2]
 LDCM0310  AC48 HEK-293T C95(1.26)  LDD1549  [2]
 LDCM0317  AC54 HEK-293T C95(1.20)  LDD1556  [2]
 LDCM0319  AC56 HEK-293T C95(1.35)  LDD1558  [2]
 LDCM0323  AC6 HEK-293T C95(1.24)  LDD1562  [2]
 LDCM0326  AC62 HEK-293T C95(1.03)  LDD1565  [2]
 LDCM0328  AC64 HEK-293T C95(1.18)  LDD1567  [2]
 LDCM0345  AC8 HEK-293T C95(1.51)  LDD1569  [2]
 LDCM0275  AKOS034007705 HEK-293T C95(1.14)  LDD1514  [2]
 LDCM0367  CL1 HEK-293T C95(0.70)  LDD1571  [2]
 LDCM0368  CL10 HEK-293T C95(1.03)  LDD1572  [2]
 LDCM0370  CL101 HEK-293T C95(0.74)  LDD1574  [2]
 LDCM0374  CL105 HEK-293T C95(0.70)  LDD1578  [2]
 LDCM0378  CL109 HEK-293T C95(0.68)  LDD1582  [2]
 LDCM0383  CL113 HEK-293T C95(0.93)  LDD1587  [2]
 LDCM0387  CL117 HEK-293T C95(0.76)  LDD1591  [2]
 LDCM0390  CL12 HEK-293T C95(1.05)  LDD1594  [2]
 LDCM0392  CL121 HEK-293T C95(0.83)  LDD1596  [2]
 LDCM0396  CL125 HEK-293T C95(0.85)  LDD1600  [2]
 LDCM0400  CL13 HEK-293T C95(0.81)  LDD1604  [2]
 LDCM0410  CL22 HEK-293T C95(1.14)  LDD1614  [2]
 LDCM0412  CL24 HEK-293T C95(1.32)  LDD1616  [2]
 LDCM0413  CL25 HEK-293T C95(0.71)  LDD1617  [2]
 LDCM0423  CL34 HEK-293T C95(1.13)  LDD1627  [2]
 LDCM0425  CL36 HEK-293T C95(1.23)  LDD1629  [2]
 LDCM0426  CL37 HEK-293T C95(0.54)  LDD1630  [2]
 LDCM0436  CL46 HEK-293T C95(1.06)  LDD1640  [2]
 LDCM0438  CL48 HEK-293T C95(1.06)  LDD1642  [2]
 LDCM0439  CL49 HEK-293T C95(0.64)  LDD1643  [2]
 LDCM0449  CL58 HEK-293T C95(1.20)  LDD1652  [2]
 LDCM0452  CL60 HEK-293T C95(1.21)  LDD1655  [2]
 LDCM0453  CL61 HEK-293T C95(0.71)  LDD1656  [2]
 LDCM0463  CL70 HEK-293T C95(1.22)  LDD1666  [2]
 LDCM0465  CL72 HEK-293T C95(1.23)  LDD1668  [2]
 LDCM0466  CL73 HEK-293T C95(0.56)  LDD1669  [2]
 LDCM0476  CL82 HEK-293T C95(1.08)  LDD1679  [2]
 LDCM0478  CL84 HEK-293T C95(1.02)  LDD1681  [2]
 LDCM0479  CL85 HEK-293T C95(0.86)  LDD1682  [2]
 LDCM0489  CL94 HEK-293T C95(1.17)  LDD1692  [2]
 LDCM0491  CL96 HEK-293T C95(1.00)  LDD1694  [2]
 LDCM0492  CL97 HEK-293T C95(0.76)  LDD1695  [2]
 LDCM0022  KB02 BRX250 C95(2.00)  LDD2269  [1]
 LDCM0023  KB03 BRX250 C95(1.98)  LDD2686  [1]
 LDCM0024  KB05 MONO-MAC-6 C95(1.85)  LDD3335  [1]

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402