Details of the Target
General Information of Target
| Target ID | LDTP00657 | |||||
|---|---|---|---|---|---|---|
| Target Name | Nucleoporin NUP42 (NUP42) | |||||
| Gene Name | NUP42 | |||||
| Gene ID | 11097 | |||||
| Synonyms |
CG1; NUPL2; Nucleoporin NUP42; NLP-1; NUP42 homolog; Nucleoporin hCG1; Nucleoporin-42; Nucleoporin-like protein 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MAICQFFLQGRCRFGDRCWNEHPGARGAGGGRQQPQQQPSGNNRRGWNTTSQRYSNVIQP
SSFSKSTPWGGSRDQEKPYFSSFDSGASTNRKEGFGLSENPFASLSPDEQKDEKKLLEGI VKDMEVWESSGQWMFSVYSPVKKKPNISGFTDISPEELRLEYHNFLTSNNLQSYLNSVQR LINQWRNRVNELKSLNISTKVALLSDVKDGVNQAAPAFGFGSSQAATFMSPGFPVNNSSS DNAQNFSFKTNSGFAAASSGSPAGFGSSPAFGAAASTSSGISTSAPAFGFGKPEVTSAAS FSFKSPAASSFGSPGFSGLPASLATGPVRAPVAPAFGGGSSVAGFGSPGSHSHTAFSKPS SDTFGNSSISTSLSASSSIIATDNVLFTPRDKLTVEELEQFQSKKFTLGKIPLKPPPLEL LNV |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Subcellular location |
Nucleus, nuclear pore complex
|
|||||
| Function |
Required for the export of mRNAs containing poly(A) tails from the nucleus into the cytoplasm.; (Microbial infection) In case of infection by HIV-1, it may participate in the docking of viral Vpr at the nuclear envelope.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
N.A. | LDD0241 | [1] | |
|
IA-alkyne Probe Info |
![]() |
C4(0.54) | LDD2182 | [2] | |
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [3] | |
|
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [3] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C094 Probe Info |
![]() |
23.26 | LDD1785 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C4(0.76) | LDD2187 | [2] |
| LDCM0572 | Fragment10 | Ramos | C4(0.43) | LDD2189 | [2] |
| LDCM0573 | Fragment11 | Ramos | C4(6.37) | LDD2190 | [2] |
| LDCM0574 | Fragment12 | Ramos | C4(0.51) | LDD2191 | [2] |
| LDCM0579 | Fragment20 | Ramos | C4(0.44) | LDD2194 | [2] |
| LDCM0580 | Fragment21 | Ramos | C4(0.70) | LDD2195 | [2] |
| LDCM0582 | Fragment23 | Ramos | C4(1.00) | LDD2196 | [2] |
| LDCM0588 | Fragment30 | Ramos | C4(0.46) | LDD2199 | [2] |
| LDCM0590 | Fragment32 | Ramos | C4(0.40) | LDD2201 | [2] |
| LDCM0596 | Fragment38 | Ramos | C4(0.75) | LDD2203 | [2] |
| LDCM0566 | Fragment4 | Ramos | C4(0.63) | LDD2184 | [2] |
| LDCM0610 | Fragment52 | Ramos | C4(0.66) | LDD2204 | [2] |
| LDCM0614 | Fragment56 | Ramos | C4(0.69) | LDD2205 | [2] |
| LDCM0569 | Fragment7 | Ramos | C4(0.61) | LDD2186 | [2] |
| LDCM0571 | Fragment9 | Ramos | C4(0.53) | LDD2188 | [2] |
| LDCM0022 | KB02 | Ramos | C4(0.54) | LDD2182 | [2] |
| LDCM0023 | KB03 | Ramos | C4(1.39) | LDD2183 | [2] |
| LDCM0024 | KB05 | Ramos | C4(0.66) | LDD2185 | [2] |
The Interaction Atlas With This Target
References





