Details of the Target
General Information of Target
Target ID | LDTP00369 | |||||
---|---|---|---|---|---|---|
Target Name | Glyceraldehyde-3-phosphate dehydrogenase, testis-specific (GAPDHS) | |||||
Gene Name | GAPDHS | |||||
Gene ID | 26330 | |||||
Synonyms |
GAPD2; GAPDH2; GAPDS; Glyceraldehyde-3-phosphate dehydrogenase, testis-specific; EC 1.2.1.12; Spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2; GAPDH-2; Spermatogenic glyceraldehyde-3-phosphate dehydrogenase
|
|||||
3D Structure | ||||||
Sequence |
MSKRDIVLTNVTVVQLLRQPCPVTRAPPPPEPKAEVEPQPQPEPTPVREEIKPPPPPLPP
HPATPPPKMVSVARELTVGINGFGRIGRLVLRACMEKGVKVVAVNDPFIDPEYMVYMFKY DSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAAS DHISAGAQRVVISAPSPDAPMFVMGVNENDYNPGSMNIVSNASCTTNCLAPLAKVIHERF GIVEGLMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNIIPASTGAAKAVTKVIPELKGKL TGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTEDEVVSTDFLG DTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLLRYMFSRDK |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Glyceraldehyde-3-phosphate dehydrogenase family
|
|||||
Subcellular location |
Cytoplasm
|
|||||
Function | May play an important role in regulating the switch between different pathways for energy production during spermiogenesis and in the spermatozoon. Required for sperm motility and male fertility. | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C319(1.16) | LDD3413 | [1] | |
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [2] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0032 | [3] | |
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [2] | |
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [4] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [5] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [4] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STS-1 Probe Info |
![]() |
N.A. | LDD0137 | [6] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0284 | AC24 | HEK-293T | C319(0.83) | LDD1523 | [7] |
LDCM0293 | AC32 | HEK-293T | C319(1.59) | LDD1532 | [7] |
LDCM0302 | AC40 | HEK-293T | C319(1.25) | LDD1541 | [7] |
LDCM0310 | AC48 | HEK-293T | C319(0.92) | LDD1549 | [7] |
LDCM0319 | AC56 | HEK-293T | C319(1.36) | LDD1558 | [7] |
LDCM0328 | AC64 | HEK-293T | C319(1.27) | LDD1567 | [7] |
LDCM0345 | AC8 | HEK-293T | C319(1.21) | LDD1569 | [7] |
LDCM0275 | AKOS034007705 | HEK-293T | C319(1.13) | LDD1514 | [7] |
LDCM0108 | Chloroacetamide | HeLa | N.A. | LDD0222 | [5] |
LDCM0390 | CL12 | HEK-293T | C319(0.97) | LDD1594 | [7] |
LDCM0412 | CL24 | HEK-293T | C319(1.05) | LDD1616 | [7] |
LDCM0425 | CL36 | HEK-293T | C319(0.87) | LDD1629 | [7] |
LDCM0438 | CL48 | HEK-293T | C319(1.32) | LDD1642 | [7] |
LDCM0452 | CL60 | HEK-293T | C319(1.48) | LDD1655 | [7] |
LDCM0465 | CL72 | HEK-293T | C319(1.18) | LDD1668 | [7] |
LDCM0478 | CL84 | HEK-293T | C319(1.13) | LDD1681 | [7] |
LDCM0491 | CL96 | HEK-293T | C319(1.71) | LDD1694 | [7] |
LDCM0625 | F8 | Ramos | C319(0.31) | LDD2187 | [8] |
LDCM0572 | Fragment10 | Ramos | C319(0.28) | LDD2189 | [8] |
LDCM0573 | Fragment11 | Ramos | C319(0.07) | LDD2190 | [8] |
LDCM0574 | Fragment12 | Ramos | C319(0.88) | LDD2191 | [8] |
LDCM0575 | Fragment13 | Ramos | C319(0.34) | LDD2192 | [8] |
LDCM0576 | Fragment14 | Ramos | C319(0.69) | LDD2193 | [8] |
LDCM0579 | Fragment20 | Ramos | C319(1.00) | LDD2194 | [8] |
LDCM0580 | Fragment21 | Ramos | C319(1.50) | LDD2195 | [8] |
LDCM0582 | Fragment23 | Ramos | C319(1.12) | LDD2196 | [8] |
LDCM0578 | Fragment27 | Ramos | C319(1.01) | LDD2197 | [8] |
LDCM0586 | Fragment28 | Ramos | C319(0.29) | LDD2198 | [8] |
LDCM0588 | Fragment30 | Ramos | C319(0.37) | LDD2199 | [8] |
LDCM0589 | Fragment31 | Ramos | C319(0.53) | LDD2200 | [8] |
LDCM0590 | Fragment32 | Ramos | C319(0.17) | LDD2201 | [8] |
LDCM0468 | Fragment33 | Ramos | C319(1.16) | LDD2202 | [8] |
LDCM0596 | Fragment38 | Ramos | C319(0.79) | LDD2203 | [8] |
LDCM0566 | Fragment4 | Ramos | C319(0.39) | LDD2184 | [8] |
LDCM0610 | Fragment52 | Ramos | C319(1.06) | LDD2204 | [8] |
LDCM0614 | Fragment56 | Ramos | C319(0.41) | LDD2205 | [8] |
LDCM0569 | Fragment7 | Ramos | C319(0.97) | LDD2186 | [8] |
LDCM0571 | Fragment9 | Ramos | C319(0.32) | LDD2188 | [8] |
LDCM0022 | KB02 | Ramos | C319(0.91) | LDD2182 | [8] |
LDCM0023 | KB03 | Ramos | C319(2.47) | LDD2183 | [8] |
LDCM0024 | KB05 | RVH-421 | C319(1.16) | LDD3413 | [1] |
LDCM0109 | NEM | HeLa | N.A. | LDD0223 | [5] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Zinc finger MYND domain-containing protein 19 (ZMYND19) | . | Q96E35 |
The Drug(s) Related To This Target
Approved
Drug Name | Drug Type | External ID | |||
---|---|---|---|---|---|
Nadh | Small molecular drug | DB00157 | |||
Artenimol | . | DB11638 | |||
Zinc | . | DB01593 | |||
Zinc Acetate | . | DB14487 | |||
Zinc Chloride | . | DB14533 | |||
Zinc Sulfate Unspecified Form | . | DB14548 |
Investigative
References