Details of the Target
General Information of Target
| Target ID | LDTP19314 | |||||
|---|---|---|---|---|---|---|
| Target Name | Coiled-coil domain-containing protein 38 (CCDC38) | |||||
| Gene Name | CCDC38 | |||||
| Gene ID | 120935 | |||||
| Synonyms |
Coiled-coil domain-containing protein 38 |
|||||
| 3D Structure | ||||||
| Sequence |
MEWELNLLLYLALFFFLLFLLFLLLFVVIKQLKNSVANTAGALQPGRLSVHREPWGFSRE
QAV |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
P1 Probe Info |
![]() |
10.00 | LDD0448 | [1] | |

