Details of the Target

General Information of Target

Target ID LDTP18359
Target Name Adipose-secreted signaling protein (ADISSP)
Gene Name ADISSP
Gene ID 54976
Synonyms
C20orf27; Adipose-secreted signaling protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNAPPAFESFLLFEGEKITINKDTKVPKACLFTINKEDHTLGNIIKSQLLKDPQVLFAGY
KVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP
Target Bioclass
Other
Family
ADISSP family
Subcellular location
Secreted
Function Adipocyte-secreted protein (adipokine) that acts as a key regulator for white adipose tissue (WAT) thermogenesis and glucose homeostasis at least in part through activation of protein kinase A (PKA).
Uniprot ID
Q9GZN8
Ensemble ID
ENST00000217195.12
HGNC ID
HGNC:15873

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
FADU Deletion: p.E166AfsTer8 .
HS578T SNV: p.P71S .
MOLT4 SNV: p.V140I IA-alkyne    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 15 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
ONAyne
 Probe Info  		K78(1.75)  LDD0274  [2]
IPM
 Probe Info  		N.A.  LDD0241  [3]
DBIA
 Probe Info  		C181(2.82)  LDD3331  [4]
BTD
 Probe Info  		C106(1.04)  LDD2089  [5]
ATP probe
 Probe Info  		N.A.  LDD0199  [6]
4-Iodoacetamidophenylacetylene
 Probe Info  		C106(0.00); C156(0.00)  LDD0038  [7]
IA-alkyne
 Probe Info  		C156(0.00); C106(0.00)  LDD0036  [7]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [7]
ENE
 Probe Info  		N.A.  LDD0006  [8]
SF
 Probe Info  		N.A.  LDD0028  [9]
STPyne
 Probe Info  		N.A.  LDD0009  [8]
VSF
 Probe Info  		N.A.  LDD0007  [8]
AOyne
 Probe Info  		15.00  LDD0443  [10]
NAIA_5
 Probe Info  		C106(0.00); C156(0.00)  LDD2223  [11]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0539  3-(4-Isopropylpiperazin-1-yl)-3-oxopropanenitrile MDA-MB-231 C106(0.69)  LDD2132  [5]
 LDCM0538  4-(Cyanoacetyl)morpholine MDA-MB-231 C106(0.71)  LDD2131  [5]
 LDCM0156  Aniline NCI-H1299 15.00  LDD0403  [1]
 LDCM0632  CL-Sc Hep-G2 C156(0.95)  LDD2227  [11]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C106(0.77)  LDD1702  [5]
 LDCM0625  F8 Ramos C156(1.18)  LDD2187  [12]
 LDCM0572  Fragment10 Ramos C156(0.69)  LDD2189  [12]
 LDCM0573  Fragment11 Ramos C156(4.97)  LDD2190  [12]
 LDCM0574  Fragment12 Ramos C156(0.42)  LDD2191  [12]
 LDCM0575  Fragment13 Ramos C156(0.91)  LDD2192  [12]
 LDCM0576  Fragment14 Ramos C156(0.46)  LDD2193  [12]
 LDCM0579  Fragment20 Ramos C156(0.77)  LDD2194  [12]
 LDCM0580  Fragment21 Ramos C156(0.68)  LDD2195  [12]
 LDCM0582  Fragment23 Ramos C156(0.65)  LDD2196  [12]
 LDCM0578  Fragment27 Ramos C156(1.14)  LDD2197  [12]
 LDCM0586  Fragment28 Ramos C156(0.67)  LDD2198  [12]
 LDCM0588  Fragment30 Ramos C156(1.03)  LDD2199  [12]
 LDCM0589  Fragment31 Ramos C156(0.68)  LDD2200  [12]
 LDCM0590  Fragment32 Ramos C156(0.52)  LDD2201  [12]
 LDCM0468  Fragment33 Ramos C156(1.87)  LDD2202  [12]
 LDCM0596  Fragment38 Ramos C156(0.53)  LDD2203  [12]
 LDCM0566  Fragment4 Ramos C156(0.78)  LDD2184  [12]
 LDCM0614  Fragment56 Ramos C156(0.96)  LDD2205  [12]
 LDCM0569  Fragment7 Ramos C156(0.60)  LDD2186  [12]
 LDCM0571  Fragment9 Ramos C156(0.61)  LDD2188  [12]
 LDCM0022  KB02 HEK-293T C156(1.01); C131(0.94); C124(0.81)  LDD1492  [13]
 LDCM0023  KB03 HEK-293T C156(1.06); C131(0.96); C124(1.08)  LDD1497  [13]
 LDCM0024  KB05 MKN-1 C181(2.82)  LDD3331  [4]
 LDCM0528  N-(4-bromophenyl)-2-cyano-N-phenylacetamide MDA-MB-231 C106(1.14)  LDD2121  [5]
 LDCM0496  Nucleophilic fragment 11a MDA-MB-231 C106(1.04)  LDD2089  [5]
 LDCM0506  Nucleophilic fragment 16a MDA-MB-231 C106(1.29)  LDD2099  [5]
 LDCM0511  Nucleophilic fragment 18b MDA-MB-231 C106(0.86)  LDD2104  [5]
 LDCM0516  Nucleophilic fragment 21a MDA-MB-231 C106(0.96)  LDD2109  [5]
 LDCM0531  Nucleophilic fragment 28b MDA-MB-231 C106(0.16)  LDD2124  [5]
 LDCM0543  Nucleophilic fragment 38 MDA-MB-231 C106(1.82)  LDD2136  [5]
 LDCM0546  Nucleophilic fragment 40 MDA-MB-231 C106(1.45)  LDD2140  [5]
 LDCM0556  Nucleophilic fragment 8a MDA-MB-231 C106(1.02)  LDD2150  [5]

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
4 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
5 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
6 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
7 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
8 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
9 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
10 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
11 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
12 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
13 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402