Details of the Target
General Information of Target
| Target ID | LDTP18359 | |||||
|---|---|---|---|---|---|---|
| Target Name | Adipose-secreted signaling protein (ADISSP) | |||||
| Gene Name | ADISSP | |||||
| Gene ID | 54976 | |||||
| Synonyms |
C20orf27; Adipose-secreted signaling protein |
|||||
| 3D Structure | ||||||
| Sequence |
MNAPPAFESFLLFEGEKITINKDTKVPKACLFTINKEDHTLGNIIKSQLLKDPQVLFAGY
KVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
ADISSP family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function | Adipocyte-secreted protein (adipokine) that acts as a key regulator for white adipose tissue (WAT) thermogenesis and glucose homeostasis at least in part through activation of protein kinase A (PKA). | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| FADU | Deletion: p.E166AfsTer8 | . | |||
| HS578T | SNV: p.P71S | . | |||
| MOLT4 | SNV: p.V140I | IA-alkyne Probe Info | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
15.00 | LDD0402 | [1] | |
|
ONAyne Probe Info |
![]() |
K78(1.75) | LDD0274 | [2] | |
|
IPM Probe Info |
![]() |
N.A. | LDD0241 | [3] | |
|
DBIA Probe Info |
![]() |
C181(2.82) | LDD3331 | [4] | |
|
BTD Probe Info |
![]() |
C106(1.04) | LDD2089 | [5] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [6] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
C106(0.00); C156(0.00) | LDD0038 | [7] | |
|
IA-alkyne Probe Info |
![]() |
C156(0.00); C106(0.00) | LDD0036 | [7] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [7] | |
|
ENE Probe Info |
![]() |
N.A. | LDD0006 | [8] | |
|
SF Probe Info |
![]() |
N.A. | LDD0028 | [9] | |
|
STPyne Probe Info |
![]() |
N.A. | LDD0009 | [8] | |
|
VSF Probe Info |
![]() |
N.A. | LDD0007 | [8] | |
|
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [10] | |
|
NAIA_5 Probe Info |
![]() |
C106(0.00); C156(0.00) | LDD2223 | [11] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0539 | 3-(4-Isopropylpiperazin-1-yl)-3-oxopropanenitrile | MDA-MB-231 | C106(0.69) | LDD2132 | [5] |
| LDCM0538 | 4-(Cyanoacetyl)morpholine | MDA-MB-231 | C106(0.71) | LDD2131 | [5] |
| LDCM0156 | Aniline | NCI-H1299 | 15.00 | LDD0403 | [1] |
| LDCM0632 | CL-Sc | Hep-G2 | C156(0.95) | LDD2227 | [11] |
| LDCM0213 | Electrophilic fragment 2 | MDA-MB-231 | C106(0.77) | LDD1702 | [5] |
| LDCM0625 | F8 | Ramos | C156(1.18) | LDD2187 | [12] |
| LDCM0572 | Fragment10 | Ramos | C156(0.69) | LDD2189 | [12] |
| LDCM0573 | Fragment11 | Ramos | C156(4.97) | LDD2190 | [12] |
| LDCM0574 | Fragment12 | Ramos | C156(0.42) | LDD2191 | [12] |
| LDCM0575 | Fragment13 | Ramos | C156(0.91) | LDD2192 | [12] |
| LDCM0576 | Fragment14 | Ramos | C156(0.46) | LDD2193 | [12] |
| LDCM0579 | Fragment20 | Ramos | C156(0.77) | LDD2194 | [12] |
| LDCM0580 | Fragment21 | Ramos | C156(0.68) | LDD2195 | [12] |
| LDCM0582 | Fragment23 | Ramos | C156(0.65) | LDD2196 | [12] |
| LDCM0578 | Fragment27 | Ramos | C156(1.14) | LDD2197 | [12] |
| LDCM0586 | Fragment28 | Ramos | C156(0.67) | LDD2198 | [12] |
| LDCM0588 | Fragment30 | Ramos | C156(1.03) | LDD2199 | [12] |
| LDCM0589 | Fragment31 | Ramos | C156(0.68) | LDD2200 | [12] |
| LDCM0590 | Fragment32 | Ramos | C156(0.52) | LDD2201 | [12] |
| LDCM0468 | Fragment33 | Ramos | C156(1.87) | LDD2202 | [12] |
| LDCM0596 | Fragment38 | Ramos | C156(0.53) | LDD2203 | [12] |
| LDCM0566 | Fragment4 | Ramos | C156(0.78) | LDD2184 | [12] |
| LDCM0614 | Fragment56 | Ramos | C156(0.96) | LDD2205 | [12] |
| LDCM0569 | Fragment7 | Ramos | C156(0.60) | LDD2186 | [12] |
| LDCM0571 | Fragment9 | Ramos | C156(0.61) | LDD2188 | [12] |
| LDCM0022 | KB02 | HEK-293T | C156(1.01); C131(0.94); C124(0.81) | LDD1492 | [13] |
| LDCM0023 | KB03 | HEK-293T | C156(1.06); C131(0.96); C124(1.08) | LDD1497 | [13] |
| LDCM0024 | KB05 | MKN-1 | C181(2.82) | LDD3331 | [4] |
| LDCM0528 | N-(4-bromophenyl)-2-cyano-N-phenylacetamide | MDA-MB-231 | C106(1.14) | LDD2121 | [5] |
| LDCM0496 | Nucleophilic fragment 11a | MDA-MB-231 | C106(1.04) | LDD2089 | [5] |
| LDCM0506 | Nucleophilic fragment 16a | MDA-MB-231 | C106(1.29) | LDD2099 | [5] |
| LDCM0511 | Nucleophilic fragment 18b | MDA-MB-231 | C106(0.86) | LDD2104 | [5] |
| LDCM0516 | Nucleophilic fragment 21a | MDA-MB-231 | C106(0.96) | LDD2109 | [5] |
| LDCM0531 | Nucleophilic fragment 28b | MDA-MB-231 | C106(0.16) | LDD2124 | [5] |
| LDCM0543 | Nucleophilic fragment 38 | MDA-MB-231 | C106(1.82) | LDD2136 | [5] |
| LDCM0546 | Nucleophilic fragment 40 | MDA-MB-231 | C106(1.45) | LDD2140 | [5] |
| LDCM0556 | Nucleophilic fragment 8a | MDA-MB-231 | C106(1.02) | LDD2150 | [5] |
References















