Details of the Target
General Information of Target
| Target ID | LDTP16710 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger protein 99 (ZNF99) | |||||
| Gene Name | ZNF99 | |||||
| Gene ID | 7652 | |||||
| Synonyms |
C19orf9; Zinc finger protein 99 |
|||||
| 3D Structure | ||||||
| Sequence |
MRIAVLFFTIFFFMSQVLPAKGKFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPLG
HQPRIESTTPKKD |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May be involved in transcriptional regulation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
P3 Probe Info |
![]() |
10.00 | LDD0454 | [1] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0224 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [3] | |
Competitor(s) Related to This Target
References



