Details of the Target
General Information of Target
| Target ID | LDTP16582 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative phosphatidylinositol 4-kinase alpha-like protein P2 (PI4KAP2) | |||||
| Gene Name | PI4KAP2 | |||||
| Synonyms |
Putative phosphatidylinositol 4-kinase alpha-like protein P2 |
|||||
| 3D Structure | ||||||
| Sequence |
MEDDEEETTASTLRGKPRPPPVSAQSAFSYIPPRRLDPKEHSYYYRPARTGIISLYDCIF
KRRLDYDQKLHRDDREHAKSLGLHVNEEEQERPVGVLTSSVYGKRINQPIEPLNRDFGRA NHVQADFYRKNDIPSLKEPGFGHIAPS |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
PI3/PI4-kinase family, Type III PI4K subfamily
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C833(4.48) | LDD3319 | [1] | |
|
IA-alkyne Probe Info |
 |
C571(3.21) | LDD0371 | [2] | |
|
CY4 Probe Info |
 |
N.A. | LDD0247 | [3] | |
|
NAIA_5 Probe Info |
 |
N.A. | LDD2223 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0025 | 4SU-RNA | HEK-293T | C571(3.21) | LDD0371 | [2] |
| LDCM0026 | 4SU-RNA+native RNA | HEK-293T | C571(3.46) | LDD0372 | [2] |
| LDCM0022 | KB02 | 697 | C833(2.32) | LDD2245 | [1] |
| LDCM0023 | KB03 | 697 | C833(5.17) | LDD2662 | [1] |
| LDCM0024 | KB05 | MEWO | C833(4.48) | LDD3319 | [1] |
References