Details of the Target
General Information of Target
| Target ID | LDTP15740 | |||||
|---|---|---|---|---|---|---|
| Target Name | GTP-binding protein Di-Ras2 (DIRAS2) | |||||
| Gene Name | DIRAS2 | |||||
| Gene ID | 54769 | |||||
| Synonyms |
GTP-binding protein Di-Ras2; Distinct subgroup of the Ras family member 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGR
LDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Small GTPase superfamily, Di-Ras family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function | Displays low GTPase activity and exists predominantly in the GTP-bound form. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C123(1.41) | LDD3365 | [1] | |
|
MPP-AC Probe Info |
![]() |
N.A. | LDD0428 | [2] | |
|
TER-AC Probe Info |
![]() |
N.A. | LDD0426 | [2] | |
|
TPP-AC Probe Info |
![]() |
N.A. | LDD0427 | [2] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References




