Details of the Target
General Information of Target
| Target ID | LDTP15563 | |||||
|---|---|---|---|---|---|---|
| Target Name | Aflatoxin B1 aldehyde reductase member 4 (AKR7L) |
|
||||
| Gene Name | AKR7L | |||||
| Gene ID | 246181 | |||||
| Synonyms |
AFAR3; AKR7A4; Aflatoxin B1 aldehyde reductase member 4; EC 1.-.-.-; AFB1 aldehyde reductase 3; AFB1-AR 3; Aldoketoreductase 7-like |
|||||
| 3D Structure | ||||||
| Sequence |
MNPLLILAFVGAAVAVPFDDDDKIVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVS
AGHCYKPHIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNRIILNNDIMLIKLSTPAVIN AHVSTISLPTAPPAAGTECLISGWGNTLSSGADYPDELQCLDAPVLTQAKCKASYPLKIT SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKRRPGVYTKVYNYVDWIK DTIAANS |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Aldo/keto reductase family, Aldo/keto reductase 2 subfamily
|
|||||
| Function |
Can reduce the dialdehyde protein-binding form of aflatoxin B1 (AFB1) to the non-binding AFB1 dialcohol. May be involved in protection of liver against the toxic and carcinogenic effects of AFB1, a potent hepatocarcinogen.
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C128(1.88) | LDD3333 | [1] | |
|
HHS-475 Probe Info |
 |
Y197(0.80); Y211(0.85) | LDD0264 | [2] | |
|
TFBX Probe Info |
 |
C186(2.19) | LDD0314 | [3] | |
|
HHS-465 Probe Info |
 |
Y197(10.00); Y211(10.00) | LDD2237 | [4] | |
|
ATP probe Probe Info |
 |
K208(0.00); K210(0.00) | LDD0199 | [5] | |
|
IA-alkyne Probe Info |
 |
C186(0.00); C128(0.00) | LDD0162 | [6] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0563 | Abegg_cp(+)-11 | HeLa | C186(2.19) | LDD0314 | [3] |
| LDCM0116 | HHS-0101 | DM93 | Y197(0.80); Y211(0.85) | LDD0264 | [2] |
| LDCM0117 | HHS-0201 | DM93 | Y197(0.99); Y211(1.08) | LDD0265 | [2] |
| LDCM0118 | HHS-0301 | DM93 | Y211(0.75); Y197(0.79) | LDD0266 | [2] |
| LDCM0119 | HHS-0401 | DM93 | Y211(0.92); Y197(1.06) | LDD0267 | [2] |
| LDCM0120 | HHS-0701 | DM93 | Y197(0.61); Y211(0.98) | LDD0268 | [2] |
| LDCM0022 | KB02 | AU565 | C128(1.28) | LDD2265 | [1] |
| LDCM0023 | KB03 | AU565 | C128(1.77) | LDD2682 | [1] |
| LDCM0024 | KB05 | MOLM-13 | C128(1.88) | LDD3333 | [1] |
References