Details of the Target
General Information of Target
| Target ID | LDTP15152 | |||||
|---|---|---|---|---|---|---|
| Target Name | Myelin protein zero-like protein 3 (MPZL3) | |||||
| Gene Name | MPZL3 | |||||
| Gene ID | 196264 | |||||
| Synonyms |
Myelin protein zero-like protein 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MAVSVLRLTVVLGLLVLFLTCYADDKPDKPDDKPDDSGKDPKPDFPKFLSLLGTEIIENA
VEFILRSMSRSTGFMEFDDNEGKHSSK |
|||||
| Target Bioclass |
Immunoglobulin
|
|||||
| Family |
Myelin P0 protein family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function | Mediates homophilic cell-cell adhesion. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
JZ128-DTB Probe Info |
![]() |
N.A. | LDD0462 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target

