Details of the Target
General Information of Target
| Target ID | LDTP14747 | |||||
|---|---|---|---|---|---|---|
| Target Name | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 (GNG2) | |||||
| Gene Name | GNG2 | |||||
| Gene ID | 54331 | |||||
| Synonyms |
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2; G gamma-I |
|||||
| 3D Structure | ||||||
| Sequence |
MITFLYIFFSILIMVLFVLGNFANGFIALVNFIDWVKRKKISSADQILTALAVSRIGLLW
ALLLNWYLTVLNPAFYSVELRITSYNAWVVTNHFSMWLAANLSIFYLLKIANFSNLLFLH LKRRVRSVILVILLGTLIFLVCHLLVANMDESMWAEEYEGNMTGKMKLRNTVHLSYLTVT TLWSFIPFTLSLISFLMLICSLCKHLKKMQLHGEGSQDLSTKVHIKALQTLISFLLLCAI FFLFLIVSVWSPRRLRNDPVVMVSKAVGNIYLAFDSFILIWRTKKLKHTFLLILCQIRC |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
G protein gamma family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
FBP2 Probe Info |
 |
3.70 | LDD0317 | [1] | |
|
IA-alkyne Probe Info |
 |
C41(2.22) | LDD2157 | [2] | |
|
DBIA Probe Info |
 |
C41(1.31) | LDD2253 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References