Details of the Target

General Information of Target

Target ID LDTP14731
Target Name Zinc finger protein 121 (ZNF121)
Gene Name ZNF121
Gene ID 7675
Synonyms
ZNF20; Zinc finger protein 121; Zinc finger protein 20
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEEC
HPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
Target Bioclass
Transcription factor
Family
Krueppel C2H2-type zinc-finger protein family
Subcellular location
Nucleus
Function May be involved in transcriptional regulation.
Uniprot ID
P58317
Ensemble ID
ENST00000320451.7
HGNC ID
HGNC:12904

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
AHL-Pu-1
 Probe Info  		C93(3.06)  LDD0169  [1]
DBIA
 Probe Info  		C93(0.91)  LDD1492  [2]
IA-alkyne
 Probe Info  		C314(0.00); C174(0.00); C180(0.00); C146(0.00)  LDD0167  [3]
IPM
 Probe Info  		N.A.  LDD0005  [4]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0025  4SU-RNA DM93 C174(2.31)  LDD0170  [1]
 LDCM0026  4SU-RNA+native RNA HEK-293T C93(3.06)  LDD0169  [1]
 LDCM0237  AC12 HEK-293T C93(0.97)  LDD1510  [2]
 LDCM0280  AC20 HEK-293T C93(0.96)  LDD1519  [2]
 LDCM0288  AC28 HEK-293T C93(1.03)  LDD1527  [2]
 LDCM0297  AC36 HEK-293T C93(0.99)  LDD1536  [2]
 LDCM0301  AC4 HEK-293T C93(0.96)  LDD1540  [2]
 LDCM0306  AC44 HEK-293T C93(0.96)  LDD1545  [2]
 LDCM0315  AC52 HEK-293T C93(0.92)  LDD1554  [2]
 LDCM0324  AC60 HEK-293T C93(1.04)  LDD1563  [2]
 LDCM0408  CL20 HEK-293T C93(0.94)  LDD1612  [2]
 LDCM0421  CL32 HEK-293T C93(1.00)  LDD1625  [2]
 LDCM0434  CL44 HEK-293T C93(1.02)  LDD1638  [2]
 LDCM0447  CL56 HEK-293T C93(1.04)  LDD1650  [2]
 LDCM0460  CL68 HEK-293T C93(1.04)  LDD1663  [2]
 LDCM0473  CL8 HEK-293T C93(0.95)  LDD1676  [2]
 LDCM0474  CL80 HEK-293T C93(1.17)  LDD1677  [2]
 LDCM0487  CL92 HEK-293T C93(1.14)  LDD1690  [2]
 LDCM0022  KB02 HEK-293T C93(0.91)  LDD1492  [2]
 LDCM0023  KB03 HEK-293T C93(1.03)  LDD1497  [2]
 LDCM0024  KB05 HEK-293T C93(1.03)  LDD1502  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
E3 ubiquitin-protein ligase TRIM41 (TRIM41) TRIM/RBCC family Q8WV44
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
RB-associated KRAB zinc finger protein (RBAK) Krueppel C2H2-type zinc-finger protein family Q9NYW8
Zinc finger protein 835 (ZNF835) Krueppel C2H2-type zinc-finger protein family Q9Y2P0
Zinc finger protein 837 (ZNF837) Krueppel C2H2-type zinc-finger protein family Q96EG3
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Kelch-like ECH-associated protein 1 (KEAP1) KEAP1 family Q14145
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410

References

1 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
2 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
3 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
4 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
5 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004