Details of the Target
General Information of Target
| Target ID | LDTP14731 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger protein 121 (ZNF121) | |||||
| Gene Name | ZNF121 | |||||
| Gene ID | 7675 | |||||
| Synonyms |
ZNF20; Zinc finger protein 121; Zinc finger protein 20 |
|||||
| 3D Structure | ||||||
| Sequence |
MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEEC
HPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May be involved in transcriptional regulation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AHL-Pu-1 Probe Info |
![]() |
C93(3.06) | LDD0169 | [1] | |
|
DBIA Probe Info |
![]() |
C93(0.91) | LDD1492 | [2] | |
|
IA-alkyne Probe Info |
![]() |
C314(0.00); C174(0.00); C180(0.00); C146(0.00) | LDD0167 | [3] | |
|
IPM Probe Info |
![]() |
N.A. | LDD0005 | [4] | |
|
Phosphinate-6 Probe Info |
![]() |
N.A. | LDD0018 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0025 | 4SU-RNA | DM93 | C174(2.31) | LDD0170 | [1] |
| LDCM0026 | 4SU-RNA+native RNA | HEK-293T | C93(3.06) | LDD0169 | [1] |
| LDCM0237 | AC12 | HEK-293T | C93(0.97) | LDD1510 | [2] |
| LDCM0280 | AC20 | HEK-293T | C93(0.96) | LDD1519 | [2] |
| LDCM0288 | AC28 | HEK-293T | C93(1.03) | LDD1527 | [2] |
| LDCM0297 | AC36 | HEK-293T | C93(0.99) | LDD1536 | [2] |
| LDCM0301 | AC4 | HEK-293T | C93(0.96) | LDD1540 | [2] |
| LDCM0306 | AC44 | HEK-293T | C93(0.96) | LDD1545 | [2] |
| LDCM0315 | AC52 | HEK-293T | C93(0.92) | LDD1554 | [2] |
| LDCM0324 | AC60 | HEK-293T | C93(1.04) | LDD1563 | [2] |
| LDCM0408 | CL20 | HEK-293T | C93(0.94) | LDD1612 | [2] |
| LDCM0421 | CL32 | HEK-293T | C93(1.00) | LDD1625 | [2] |
| LDCM0434 | CL44 | HEK-293T | C93(1.02) | LDD1638 | [2] |
| LDCM0447 | CL56 | HEK-293T | C93(1.04) | LDD1650 | [2] |
| LDCM0460 | CL68 | HEK-293T | C93(1.04) | LDD1663 | [2] |
| LDCM0473 | CL8 | HEK-293T | C93(0.95) | LDD1676 | [2] |
| LDCM0474 | CL80 | HEK-293T | C93(1.17) | LDD1677 | [2] |
| LDCM0487 | CL92 | HEK-293T | C93(1.14) | LDD1690 | [2] |
| LDCM0022 | KB02 | HEK-293T | C93(0.91) | LDD1492 | [2] |
| LDCM0023 | KB03 | HEK-293T | C93(1.03) | LDD1497 | [2] |
| LDCM0024 | KB05 | HEK-293T | C93(1.03) | LDD1502 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase TRIM41 (TRIM41) | TRIM/RBCC family | Q8WV44 | |||
Transcription factor
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Kelch-like ECH-associated protein 1 (KEAP1) | KEAP1 family | Q14145 | |||
| Keratin-associated protein 10-8 (KRTAP10-8) | KRTAP type 10 family | P60410 | |||
References





