Details of the Target

General Information of Target

Target ID LDTP14429
Target Name Eukaryotic translation initiation factor 1A, Y-chromosomal (EIF1AY)
Gene Name EIF1AY
Gene ID 9086
Synonyms
Eukaryotic translation initiation factor 1A, Y-chromosomal; eIF-1A Y isoform; eIF1A Y isoform; Eukaryotic translation initiation factor 4C; eIF-4C
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHRLLKNGNVRNT
LLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK
Target Bioclass
Other
Family
EIF-1A family
Function
Component of the 43S pre-initiation complex (43S PIC), which binds to the mRNA cap-proximal region, scans mRNA 5'-untranslated region, and locates the initiation codon. This protein enhances formation of the cap-proximal complex. Together with EIF1, facilitates scanning, start codon recognition, promotion of the assembly of 48S complex at the initiation codon (43S PIC becomes 48S PIC after the start codon is reached), and dissociation of aberrant complexes. After start codon location, together with EIF5B orients the initiator methionine-tRNA in a conformation that allows 60S ribosomal subunit joining to form the 80S initiation complex. Is released after 80S initiation complex formation, just after GTP hydrolysis by EIF5B, and before release of EIF5B. Its globular part is located in the A site of the 40S ribosomal subunit. Its interaction with EIF5 during scanning contribute to the maintenance of EIF1 within the open 43S PIC. In contrast to yeast orthologs, does not bind EIF1.
Uniprot ID
O14602
Ensemble ID
ENST00000361365.7
HGNC ID
HGNC:3252

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 13 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K104(6.69); K88(3.17)  LDD0277  [1]
AZ-9
 Probe Info  		E111(1.26)  LDD2208  [2]
ONAyne
 Probe Info  		N.A.  LDD0273  [1]
Probe 1
 Probe Info  		Y35(52.51); Y84(251.24); Y95(35.00); Y106(158.96)  LDD3495  [3]
HHS-475
 Probe Info  		Y106(0.82)  LDD0264  [4]
HHS-465
 Probe Info  		Y106(7.24)  LDD2237  [5]
Acrolein
 Probe Info  		N.A.  LDD0221  [6]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [7]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [7]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [7]
1c-yne
 Probe Info  		K104(0.00); K29(0.00)  LDD0228  [8]
Crotonaldehyde
 Probe Info  		N.A.  LDD0219  [6]
NAIA_5
 Probe Info  		N.A.  LDD2223  [9]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
pLen
 Probe Info  		2.23  LDD0256  [10]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0116  HHS-0101 DM93 Y106(0.82)  LDD0264  [4]
 LDCM0117  HHS-0201 DM93 Y106(0.73)  LDD0265  [4]
 LDCM0118  HHS-0301 DM93 Y106(0.71)  LDD0266  [4]
 LDCM0119  HHS-0401 DM93 Y106(0.73)  LDD0267  [4]
 LDCM0120  HHS-0701 DM93 Y106(0.60)  LDD0268  [4]
 LDCM0107  IAA HeLa N.A.  LDD0221  [6]
 LDCM0115  Minimalist HEK-293T 2.23  LDD0256  [10]
 LDCM0109  NEM HeLa N.A.  LDD0223  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Eukaryotic translation initiation factor 5B (EIF5B) . O60841
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Huntingtin (HTT) Huntingtin family P42858
Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ataxin-1 (ATXN1) ATXN1 family P54253

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
3 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
4 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
5 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
6 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
7 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
8 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
9 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
10 Development of Photolenalidomide for Cellular Target Identification. J Am Chem Soc. 2022 Jan 12;144(1):606-614. doi: 10.1021/jacs.1c11920. Epub 2022 Jan 3.