Details of the Target
General Information of Target
| Target ID | LDTP14286 | |||||
|---|---|---|---|---|---|---|
| Target Name | AP-1 complex subunit mu-2 (AP1M2) | |||||
| Gene Name | AP1M2 | |||||
| Gene ID | 10053 | |||||
| Synonyms |
AP-1 complex subunit mu-2; AP-mu chain family member mu1B; Adaptor protein complex AP-1 subunit mu-2; Adaptor-related protein complex 1 subunit mu-2; Clathrin assembly protein complex 1 mu-2 medium chain 2; Golgi adaptor HA1/AP1 adaptin mu-2 subunit; Mu-adaptin 2; Mu1B-adaptin
|
|||||
| 3D Structure | ||||||
| Sequence |
MCSTNPGKWVTFDDDPAVQSSQKSKNFPLENQGVCRPNGLKLNLPGLREFPSGSSSTSST
PLSSPIVDFYFSPGPPSNSPLSTPTKDFPGFPGIPKAGTHVLYPIPESSSDSPLAISGGE SSLLPTRPTCLSHALLPSDHSCTHPTPKVGLPDEVNPQQAESLGFQSDDLPQFQYFREDC AFSSPFWKDEGSDSHFTLDPPGSKKMFSSRNKEMPIDQKSLNKCSLNYICEKLEHLQSAE NQDSLRSLSMHCLCAEENASSFVPHTLFRSQPKSGWSFMLRIPEKKNMMSSRQWGPIFLK VLPGGILQMYYEQGLEKPFKEIQLDPYCRLSEPKVENFSVAGKIHTVKIEHVSYTEKRKY HSKTEVVHEPDIEQMLKLGSTSYHDFLDFLTTVEEELMKLPAVSKPKKNYEEQEISLEIV DNFWGKVTKEGKFVESAVITQIYCLCFVNGNLECFLTLNDLELPKRDESYYEKDSEKKGI DILDYHFHKCVNVQEFEQSRIIKFVPLDACRFELMRFKTLYNGDNLPFSLKSVVVVQGAY VELQAFVNMASLAQRSSYAGSLRSCDNIRIHFPVPSQWIKALWTMNLQRQKSLKAKMNRR ACLGSLQELESEPVIQVTVGSAKYESAYQAVVWKIDRLPDKNSSLDHPHCLSYKLELGSD QEIPSDWYPFATVQFSVPDTCASRTEVRSLGVESDVQPQKHVQQRACYNIQVEIEKKWIK IDGEDPDKIGDCITQ |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Adaptor complexes medium subunit family
|
|||||
| Subcellular location |
Golgi apparatus
|
|||||
| Function |
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| HCC70 | SNV: p.N339S | . | |||
| HT115 | SNV: p.K227N | . | |||
| IM95 | SNV: p.R104W | DBIA Probe Info | |||
| LN18 | SNV: p.E93K | DBIA Probe Info | |||
| MOLT4 | SNV: p.E311D | IA-alkyne Probe Info | |||
| PEO1 | SNV: p.R251G | . | |||
| SKMEL24 | SNV: p.E42Ter | DBIA Probe Info | |||
| TOV21G | SNV: p.P123Q | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C253(2.84) | LDD3310 | [1] | |
|
BTD Probe Info |
![]() |
C241(1.59) | LDD2092 | [2] | |
|
IPM Probe Info |
![]() |
C241(1.18) | LDD1702 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0502 | 1-(Cyanoacetyl)piperidine | MDA-MB-231 | C241(0.44) | LDD2095 | [2] |
| LDCM0025 | 4SU-RNA | HEK-293T | C241(20.00) | LDD0371 | [4] |
| LDCM0026 | 4SU-RNA+native RNA | HEK-293T | C241(9.74) | LDD0372 | [4] |
| LDCM0545 | Acetamide | MDA-MB-231 | C241(0.63) | LDD2138 | [2] |
| LDCM0213 | Electrophilic fragment 2 | MDA-MB-231 | C241(1.18) | LDD1702 | [2] |
| LDCM0022 | KB02 | 22RV1 | C92(1.82) | LDD2243 | [1] |
| LDCM0023 | KB03 | 22RV1 | C92(3.28) | LDD2660 | [1] |
| LDCM0024 | KB05 | COLO792 | C253(2.84) | LDD3310 | [1] |
| LDCM0499 | Nucleophilic fragment 12b | MDA-MB-231 | C241(1.59) | LDD2092 | [2] |
| LDCM0500 | Nucleophilic fragment 13a | MDA-MB-231 | C241(1.17) | LDD2093 | [2] |
| LDCM0501 | Nucleophilic fragment 13b | MDA-MB-231 | C241(1.89) | LDD2094 | [2] |
| LDCM0505 | Nucleophilic fragment 15b | MDA-MB-231 | C241(0.87) | LDD2098 | [2] |
| LDCM0508 | Nucleophilic fragment 17a | MDA-MB-231 | C241(0.88) | LDD2101 | [2] |
| LDCM0523 | Nucleophilic fragment 24b | MDA-MB-231 | C241(0.11) | LDD2116 | [2] |
| LDCM0535 | Nucleophilic fragment 30b | MDA-MB-231 | C241(0.87) | LDD2128 | [2] |
| LDCM0540 | Nucleophilic fragment 35 | MDA-MB-231 | C241(0.81) | LDD2133 | [2] |
| LDCM0547 | Nucleophilic fragment 41 | MDA-MB-231 | C241(0.27) | LDD2141 | [2] |
| LDCM0554 | Nucleophilic fragment 7a | MDA-MB-231 | C241(0.41) | LDD2148 | [2] |
The Interaction Atlas With This Target
References




