General Information of Target

Target ID LDTP14087
Target Name DNA-directed RNA polymerase III subunit RPC8 (POLR3H)
Gene Name POLR3H
Gene ID 171568
Synonyms
KIAA1665; RPC8; DNA-directed RNA polymerase III subunit RPC8; RNA polymerase III subunit C8; DNA-directed RNA polymerase III subunit H; RNA polymerase III subunit 22.9 kDa subunit; RPC22.9
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLN
QQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRI
GCGLDRLQWENVSAMIEEVFEATDIKITVYTL
Target Bioclass
Enzyme
Family
Eukaryotic RPB7/RPC8 RNA polymerase subunit family
Subcellular location
Nucleus
Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III (Pol III) which synthesizes small non-coding RNAs including 5S rRNA, snRNAs, tRNAs and miRNAs from at least 500 distinct genomic loci. With CRCP/RPC9 forms a mobile stalk that protrudes from Pol III core and functions primarily in transcription initiation. Pol III plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF-kappa-B through the RIG-I pathway.
Uniprot ID
Q9Y535
Ensemble ID
ENST00000337566.9
HGNC ID
HGNC:30349

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
MFE319 SNV: p.D139N .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C74(0.67)  LDD1511  [1]
ATP probe
 Probe Info 
K32(0.00); K33(0.00)  LDD0199  [2]
N1
 Probe Info 
N.A.  LDD0245  [3]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
VE-P
 Probe Info 
N.A.  LDD0396  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0270  AC15 HEK-293T C74(1.40)  LDD1513  [1]
 LDCM0281  AC21 HEK-293T C74(0.91)  LDD1520  [1]
 LDCM0283  AC23 HEK-293T C74(1.13)  LDD1522  [1]
 LDCM0289  AC29 HEK-293T C74(0.79)  LDD1528  [1]
 LDCM0292  AC31 HEK-293T C74(0.98)  LDD1531  [1]
 LDCM0298  AC37 HEK-293T C74(0.73)  LDD1537  [1]
 LDCM0300  AC39 HEK-293T C74(0.88)  LDD1539  [1]
 LDCM0307  AC45 HEK-293T C74(0.83)  LDD1546  [1]
 LDCM0309  AC47 HEK-293T C74(1.50)  LDD1548  [1]
 LDCM0312  AC5 HEK-293T C74(0.79)  LDD1551  [1]
 LDCM0316  AC53 HEK-293T C74(1.02)  LDD1555  [1]
 LDCM0318  AC55 HEK-293T C74(1.04)  LDD1557  [1]
 LDCM0325  AC61 HEK-293T C74(1.31)  LDD1564  [1]
 LDCM0327  AC63 HEK-293T C74(1.22)  LDD1566  [1]
 LDCM0334  AC7 HEK-293T C74(1.43)  LDD1568  [1]
 LDCM0248  AKOS034007472 HEK-293T C74(0.67)  LDD1511  [1]
 LDCM0379  CL11 HEK-293T C74(1.09)  LDD1583  [1]
 LDCM0409  CL21 HEK-293T C74(0.57)  LDD1613  [1]
 LDCM0411  CL23 HEK-293T C74(1.10)  LDD1615  [1]
 LDCM0422  CL33 HEK-293T C74(0.67)  LDD1626  [1]
 LDCM0424  CL35 HEK-293T C74(1.01)  LDD1628  [1]
 LDCM0435  CL45 HEK-293T C74(0.27)  LDD1639  [1]
 LDCM0437  CL47 HEK-293T C74(0.95)  LDD1641  [1]
 LDCM0448  CL57 HEK-293T C74(0.89)  LDD1651  [1]
 LDCM0450  CL59 HEK-293T C74(1.31)  LDD1653  [1]
 LDCM0461  CL69 HEK-293T C74(0.68)  LDD1664  [1]
 LDCM0464  CL71 HEK-293T C74(1.07)  LDD1667  [1]
 LDCM0475  CL81 HEK-293T C74(0.83)  LDD1678  [1]
 LDCM0477  CL83 HEK-293T C74(1.20)  LDD1680  [1]
 LDCM0484  CL9 HEK-293T C74(0.82)  LDD1687  [1]
 LDCM0488  CL93 HEK-293T C74(0.79)  LDD1691  [1]
 LDCM0490  CL95 HEK-293T C74(0.90)  LDD1693  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ATP synthase mitochondrial F1 complex assembly factor 2 (ATPAF2) ATP12 family Q8N5M1

References

1 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
2 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
3 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.
4 Pharmacological Targeting of Vacuolar H(+)-ATPase via Subunit V1G Combats Multidrug-Resistant Cancer. Cell Chem Biol. 2020 Nov 19;27(11):1359-1370.e8. doi: 10.1016/j.chembiol.2020.06.011. Epub 2020 Jul 9.