Details of the Target

General Information of Target

Target ID LDTP14014
Target Name Chromatin target of PRMT1 protein (CHTOP)
Gene Name CHTOP
Gene ID 26097
Synonyms
C1orf77; FOP; Chromatin target of PRMT1 protein; Friend of PRMT1 protein; Small arginine- and glycine-rich protein; SRAG
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAEPVQEELSVLAAIFCRPHEWEVLSRSETDGTVFRIHTKAEGFMDVDIPLELVFHLPVN
YPSCLPGISINSEQLTRAQCVTVKENLLEQAESLLSEPMVHELVLWIQQNLRHILSQPET
GSGSEKCTFSTSTTMDDGLWITLLHLDHMRAKTKYVKIVEKWASDLRLTGRLMFMGKIIL
ILLQGDRNNLKEYLILQKTSKVDVDSSGKKCKEKMISVLFETKVQTEHKRFLAFEVKEYS
ALDELQKEFETAGLKKLFSEFVLALVK
Target Bioclass
Other
Subcellular location
Nucleus
Function
Plays an important role in the ligand-dependent activation of estrogen receptor target genes. May play a role in the silencing of fetal globin genes. Recruits the 5FMC complex to ZNF148, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes. Plays an important role in the tumorigenicity of glioblastoma cells. Binds to 5-hydroxymethylcytosine (5hmC) and associates with the methylosome complex containing PRMT1, PRMT5, MEP50 and ERH. The CHTOP-methylosome complex associated with 5hmC is recruited to selective sites on the chromosome, where it methylates H4R3 and activates the transcription of genes involved in glioblastomagenesis.; Required for effective mRNA nuclear export and is a component of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. Stimulates DDX39B ATPase and helicase activities. In cooperation with ALYREF/THOC4 enhances NXF1 RNA binding activity.
Uniprot ID
Q9Y3Y2
Ensemble ID
ENST00000368690.7
HGNC ID
HGNC:24511

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CCLP1 SNV: p.R174P .
CHL1 SNV: p.G161D .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C-Sul
 Probe Info  		11.44  LDD0066  [1]
STPyne
 Probe Info  		K28(6.64)  LDD0277  [2]
Probe 1
 Probe Info  		Y223(13.60)  LDD3495  [3]
Acrolein
 Probe Info  		N.A.  LDD0227  [4]
ATP probe
 Probe Info  		K30(0.00); K226(0.00); K228(0.00)  LDD0199  [5]
NHS
 Probe Info  		K226(0.00); K8(0.00)  LDD0010  [6]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
CR-1
 Probe Info  		3.12  LDD0430  [7]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0168  Crenolanib MV4-11 3.12  LDD0430  [7]
 LDCM0109  NEM HeLa N.A.  LDD0227  [4]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein arginine N-methyltransferase 1 (PRMT1) Protein arginine N-methyltransferase family Q99873
DNA dC->dU-editing enzyme APOBEC-3C (APOBEC3C) Cytidine and deoxycytidylate deaminase family Q9NRW3
ATP-dependent RNA helicase DDX39A (DDX39A) DEAD box helicase family O00148
Spliceosome RNA helicase DDX39B (DDX39B) DEAD box helicase family Q13838
SRSF protein kinase 2 (SRPK2) CMGC Ser/Thr protein kinase family P78362
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
THO complex subunit 4 (ALYREF) ALYREF family Q86V81
Nuclear RNA export factor 1 (NXF1) NXF family Q9UBU9
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Enhancer of rudimentary homolog (ERH) E(R) family P84090
Other
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
KH domain-containing, RNA-binding, signal transduction-associated protein 2 (KHDRBS2) KHDRBS family Q5VWX1
U1 small nuclear ribonucleoprotein A (SNRPA) RRM U1 A/B'' family P09012
Survival motor neuron protein (SMN1; SMN2) SMN family Q16637
RNA-binding protein 3 (RBM3) . P98179

References

1 Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
4 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
5 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
6 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
7 Crenolanib-Derived Probes Suitable for Cell- and Tissue-Based Protein Profiling and Single-Cell Imaging. Chembiochem. 2019 Jul 15;20(14):1783-1788. doi: 10.1002/cbic.201900067. Epub 2019 Jul 3.