Details of the Target

General Information of Target

Target ID LDTP13793
Target Name Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 (PIN4)
Gene Name PIN4
Gene ID 5303
Synonyms
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4; EC 5.2.1.8; Parvulin-14; Par14; hPar14; Parvulin-17; Par17; hPar17; Peptidyl-prolyl cis-trans isomerase Pin4; PPIase Pin4; Peptidyl-prolyl cis/trans isomerase EPVH; hEPVH; Rotamase Pin4
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVE
YSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVT
WYVSSSPCAACADRIIKTLSKTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMK
PQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILK
Target Bioclass
Enzyme
Family
PpiC/parvulin rotamase family, PIN4 subfamily
Subcellular location
Nucleus, nucleolus; Mitochondrion
Function Isoform 1 is involved as a ribosomal RNA processing factor in ribosome biogenesis. Binds to tightly bent AT-rich stretches of double-stranded DNA.; Isoform 2 binds to double-stranded DNA.
Uniprot ID
Q9Y237
Ensemble ID
ENST00000373669.8
HGNC ID
HGNC:8992
ChEMBL ID
CHEMBL4923

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
MCC13 Substitution: p.P31L .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 17 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH214
 Probe Info  		Y71(20.00)  LDD0258  [1]
STPyne
 Probe Info  		K14(3.39); K27(7.46)  LDD0277  [2]
Probe 1
 Probe Info  		Y71(13.98)  LDD3495  [3]
DBIA
 Probe Info  		C70(1.81)  LDD3377  [4]
BTD
 Probe Info  		C45(1.06)  LDD2113  [5]
HHS-475
 Probe Info  		Y71(0.43)  LDD0264  [6]
HHS-465
 Probe Info  		Y122(10.00)  LDD2237  [7]
ATP probe
 Probe Info  		K75(0.00); K119(0.00); K47(0.00); K50(0.00)  LDD0199  [8]
m-APA
 Probe Info  		N.A.  LDD2234  [9]
IA-alkyne
 Probe Info  		N.A.  LDD0162  [10]
1d-yne
 Probe Info  		N.A.  LDD0356  [11]
NHS
 Probe Info  		K75(0.00); K14(0.00)  LDD0010  [12]
SF
 Probe Info  		K32(0.00); K26(0.00); K14(0.00)  LDD0028  [13]
1c-yne
 Probe Info  		N.A.  LDD0228  [11]
Acrolein
 Probe Info  		N.A.  LDD0217  [14]
Methacrolein
 Probe Info  		N.A.  LDD0218  [14]
NAIA_5
 Probe Info  		N.A.  LDD2223  [15]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C326
 Probe Info  		7.57  LDD1990  [16]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0520  AKOS000195272 MDA-MB-231 C45(1.06)  LDD2113  [5]
 LDCM0116  HHS-0101 DM93 Y71(0.43)  LDD0264  [6]
 LDCM0117  HHS-0201 DM93 Y71(0.61)  LDD0265  [6]
 LDCM0118  HHS-0301 DM93 Y71(0.30)  LDD0266  [6]
 LDCM0119  HHS-0401 DM93 Y71(0.59)  LDD0267  [6]
 LDCM0120  HHS-0701 DM93 Y71(0.83)  LDD0268  [6]
 LDCM0022  KB02 ICC108 C70(1.33)  LDD2381  [4]
 LDCM0023  KB03 ICC108 C70(1.53)  LDD2798  [4]
 LDCM0024  KB05 OPM-2 C70(1.81)  LDD3377  [4]
 LDCM0109  NEM HeLa N.A.  LDD0224  [14]
 LDCM0527  Nucleophilic fragment 26b MDA-MB-231 C45(1.01)  LDD2120  [5]
 LDCM0535  Nucleophilic fragment 30b MDA-MB-231 C45(0.98)  LDD2128  [5]
 LDCM0549  Nucleophilic fragment 43 MDA-MB-231 C45(1.43)  LDD2143  [5]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger and BTB domain-containing protein 9 (ZBTB9) . Q96C00
Other
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Centrosomal protein of 72 kDa (CEP72) CEP72 family Q9P209
Protein FAM9B (FAM9B) FAM9 family Q8IZU0
Paraneoplastic antigen Ma1 (PNMA1) PNMA family Q8ND90
Fetal and adult testis-expressed transcript protein (FATE1) . Q969F0
Melanoma-associated antigen 11 (MAGEA11) . P43364

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
4 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
5 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
6 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
7 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
8 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
9 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
10 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
11 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
12 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
13 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
14 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
15 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
16 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587