Details of the Target
General Information of Target
Target ID | LDTP13764 | |||||
---|---|---|---|---|---|---|
Target Name | Histone deacetylase 5 (HDAC5) | |||||
Gene Name | HDAC5 | |||||
Gene ID | 10014 | |||||
Synonyms |
KIAA0600; Histone deacetylase 5; HD5; EC 3.5.1.98; Antigen NY-CO-9 |
|||||
3D Structure | ||||||
Sequence |
MSCTRMIQVLDPRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKS
CLNIKHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLN DISSALKHHEEKNLILDFPQPSTDYLSFRSHFQKNFVCLENCSLQERTVTGTVKVKNVSF EKKVQIRITFDSWKNYTDVDCVYMKNVYGGTDSDTFSFAIDLPPVIPTEQKIEFCISYHA NGQVFWDNNDGQNYRIVHVQWKPDGVQTQMAPQDCAFHQTSPKTELESTIFGSPRLASGL FPEWQSWGRMENLASYR |
|||||
Target Type |
Patented-recorded
|
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Histone deacetylase family, HD type 2 subfamily
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation by repressing transcription of myocyte enhancer MEF2C. During muscle differentiation, it shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer. Serves as a corepressor of RARA and causes its deacetylation. In association with RARA, plays a role in the repression of microRNA-10a and thereby in the inflammatory response.
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C807(1.05) | LDD1514 | [1] | |
AOyne Probe Info |
![]() |
13.00 | LDD0443 | [2] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0284 | AC24 | HEK-293T | C807(1.05) | LDD1523 | [1] |
LDCM0293 | AC32 | HEK-293T | C807(1.15) | LDD1532 | [1] |
LDCM0302 | AC40 | HEK-293T | C807(0.98) | LDD1541 | [1] |
LDCM0310 | AC48 | HEK-293T | C807(0.92) | LDD1549 | [1] |
LDCM0319 | AC56 | HEK-293T | C807(1.07) | LDD1558 | [1] |
LDCM0328 | AC64 | HEK-293T | C807(1.04) | LDD1567 | [1] |
LDCM0345 | AC8 | HEK-293T | C807(1.00) | LDD1569 | [1] |
LDCM0275 | AKOS034007705 | HEK-293T | C807(1.05) | LDD1514 | [1] |
LDCM0367 | CL1 | HEK-293T | C698(1.00) | LDD1571 | [1] |
LDCM0370 | CL101 | HEK-293T | C698(0.85) | LDD1574 | [1] |
LDCM0374 | CL105 | HEK-293T | C698(0.98) | LDD1578 | [1] |
LDCM0378 | CL109 | HEK-293T | C698(0.91) | LDD1582 | [1] |
LDCM0383 | CL113 | HEK-293T | C698(0.95) | LDD1587 | [1] |
LDCM0387 | CL117 | HEK-293T | C698(0.81) | LDD1591 | [1] |
LDCM0390 | CL12 | HEK-293T | C807(1.12) | LDD1594 | [1] |
LDCM0392 | CL121 | HEK-293T | C698(0.99) | LDD1596 | [1] |
LDCM0396 | CL125 | HEK-293T | C698(0.98) | LDD1600 | [1] |
LDCM0400 | CL13 | HEK-293T | C698(0.89) | LDD1604 | [1] |
LDCM0412 | CL24 | HEK-293T | C807(1.22) | LDD1616 | [1] |
LDCM0413 | CL25 | HEK-293T | C698(0.77) | LDD1617 | [1] |
LDCM0425 | CL36 | HEK-293T | C807(1.22) | LDD1629 | [1] |
LDCM0426 | CL37 | HEK-293T | C698(0.91) | LDD1630 | [1] |
LDCM0438 | CL48 | HEK-293T | C807(1.19) | LDD1642 | [1] |
LDCM0439 | CL49 | HEK-293T | C698(1.40) | LDD1643 | [1] |
LDCM0452 | CL60 | HEK-293T | C807(1.16) | LDD1655 | [1] |
LDCM0453 | CL61 | HEK-293T | C698(0.91) | LDD1656 | [1] |
LDCM0465 | CL72 | HEK-293T | C807(1.20) | LDD1668 | [1] |
LDCM0466 | CL73 | HEK-293T | C698(1.32) | LDD1669 | [1] |
LDCM0478 | CL84 | HEK-293T | C807(1.09) | LDD1681 | [1] |
LDCM0479 | CL85 | HEK-293T | C698(1.24) | LDD1682 | [1] |
LDCM0491 | CL96 | HEK-293T | C807(1.34) | LDD1694 | [1] |
LDCM0492 | CL97 | HEK-293T | C698(0.67) | LDD1695 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Histone deacetylase 5 (HDAC5) | Histone deacetylase family | Q9UQL6 |
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
14-3-3 protein zeta/delta (YWHAZ) | 14-3-3 family | P63104 |
Transcription factor
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
14-3-3 protein sigma (SFN) | 14-3-3 family | P31947 | |||
Breast cancer metastasis-suppressor 1 (BRMS1) | BRMS1 family | Q9HCU9 | |||
Ankyrin repeat family A protein 2 (ANKRA2) | . | Q9H9E1 |
The Drug(s) Related To This Target
Approved
Investigative
Drug Name | Drug Type | External ID | |||
---|---|---|---|---|---|
Abexinostat | Small molecular drug | DB12565 | |||
Tmp269 | Small molecular drug | D0R7JA |
Patented
References