Details of the Target
General Information of Target
Target ID | LDTP13596 | |||||
---|---|---|---|---|---|---|
Target Name | Signal-transducing adaptor protein 1 (STAP1) | |||||
Gene Name | STAP1 | |||||
Gene ID | 26228 | |||||
Synonyms |
BRDG1; Signal-transducing adaptor protein 1; STAP-1; BCR downstream-signaling protein 1; Docking protein BRDG1; Stem cell adaptor protein 1 |
|||||
3D Structure | ||||||
Sequence |
MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF |
|||||
Target Bioclass |
Other
|
|||||
Subcellular location |
Nucleus
|
|||||
Function | In BCR signaling, appears to function as a docking protein acting downstream of TEC and participates in a positive feedback loop by increasing the activity of TEC. | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C178(1.55); C269(1.91); C76(0.71) | LDD3339 | [1] | |
IA-alkyne Probe Info |
![]() |
C269(3.35) | LDD2182 | [2] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
VE-P Probe Info |
![]() |
N.A. | LDD0396 | [3] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0625 | F8 | Ramos | C269(2.11) | LDD2187 | [2] |
LDCM0572 | Fragment10 | Ramos | C269(1.86) | LDD2189 | [2] |
LDCM0573 | Fragment11 | Ramos | C269(0.02) | LDD2190 | [2] |
LDCM0574 | Fragment12 | Ramos | C269(0.70) | LDD2191 | [2] |
LDCM0575 | Fragment13 | Ramos | C269(0.91) | LDD2192 | [2] |
LDCM0576 | Fragment14 | Ramos | C269(0.55) | LDD2193 | [2] |
LDCM0579 | Fragment20 | Ramos | C269(0.73) | LDD2194 | [2] |
LDCM0580 | Fragment21 | Ramos | C269(1.01) | LDD2195 | [2] |
LDCM0582 | Fragment23 | Ramos | C269(1.18) | LDD2196 | [2] |
LDCM0578 | Fragment27 | Ramos | C269(1.06) | LDD2197 | [2] |
LDCM0586 | Fragment28 | Ramos | C269(0.57) | LDD2198 | [2] |
LDCM0588 | Fragment30 | Ramos | C269(1.42) | LDD2199 | [2] |
LDCM0589 | Fragment31 | Ramos | C269(0.84) | LDD2200 | [2] |
LDCM0590 | Fragment32 | Ramos | C269(1.06) | LDD2201 | [2] |
LDCM0468 | Fragment33 | Ramos | C269(0.85) | LDD2202 | [2] |
LDCM0596 | Fragment38 | Ramos | C269(0.79) | LDD2203 | [2] |
LDCM0566 | Fragment4 | Ramos | C269(1.33) | LDD2184 | [2] |
LDCM0610 | Fragment52 | Ramos | C269(0.82) | LDD2204 | [2] |
LDCM0614 | Fragment56 | Ramos | C269(1.17) | LDD2205 | [2] |
LDCM0569 | Fragment7 | Ramos | C269(2.78) | LDD2186 | [2] |
LDCM0571 | Fragment9 | Ramos | C269(0.89) | LDD2188 | [2] |
LDCM0022 | KB02 | Ramos | C269(3.35) | LDD2182 | [2] |
LDCM0023 | KB03 | Ramos | C269(0.78) | LDD2183 | [2] |
LDCM0024 | KB05 | NALM-6 | C178(1.55); C269(1.91); C76(0.71) | LDD3339 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Hepatocyte growth factor receptor (MET) | Tyr protein kinase family | P08581 | |||
Mast/stem cell growth factor receptor Kit (KIT) | Tyr protein kinase family | P10721 |
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Androgen receptor (AR) | Nuclear hormone receptor family | P10275 |
Other
References