Details of the Target

General Information of Target

Target ID LDTP13485
Target Name Zinc finger protein Aiolos (IKZF3)
Gene Name IKZF3
Gene ID 22806
Synonyms
ZNFN1A3; Zinc finger protein Aiolos; Ikaros family zinc finger protein 3
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MERKDFETWLDNISVTFLSLTDLQKNETLDHLISLSGAVQLRHLSNNLETLLKRDFLKLL
PLELSFYLLKWLDPQTLLTCCLVSKQWNKVISACTEVWQTACKNLGWQIDDSVQDALHWK
KVYLKAILRMKQLEDHEAFETSSLIGHSARVYALYYKDGLLCTGSDDLSAKLWDVSTGQC
VYGIQTHTCAAVKFDEQKLVTGSFDNTVACWEWSSGARTQHFRGHTGAVFSVDYNDELDI
LVSGSADFTVKVWALSAGTCLNTLTGHTEWVTKVVLQKCKVKSLLHSPGDYILLSADKYE
IKIWPIGREINCKCLKTLSVSEDRSICLQPRLHFDGKYIVCSSALGLYQWDFASYDILRV
IKTPEIANLALLGFGDIFALLFDNRYLYIMDLRTESLISRWPLPEYRKSKRGSSFLAGEA
SWLNGLDGHNDTGLVFATSMPDHSIHLVLWKEHG
Target Type
Clinical trial
Target Bioclass
Transcription factor
Family
Ikaros C2H2-type zinc-finger protein family
Subcellular location
Cytoplasm; Nucleus
Function
Transcription factor that plays an important role in the regulation of lymphocyte differentiation. Plays an essential role in regulation of B-cell differentiation, proliferation and maturation to an effector state. Involved in regulating BCL2 expression and controlling apoptosis in T-cells in an IL2-dependent manner.
TTD ID
T63173
Uniprot ID
Q9UKT9
DrugMap ID
TTCZVFZ
Ensemble ID
ENST00000293068.9
HGNC ID
HGNC:13178
ChEMBL ID
CHEMBL4739707

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCT15 SNV: p.R194S .
HT SNV: p.F146I DBIA    Probe Info 
MFE319 SNV: p.M406V .
MOLT4 SNV: p.D305E; p.L427F; p.R488Ter .
NCIH1793 SNV: p.P173R .
PF382 SNV: p.M341I .
REC1 SNV: p.L162R .
SHP77 SNV: p.H220Q .
SISO SNV: p.S126F .
SW1271 SNV: p.E240Ter .
TFK1 SNV: p.Ter510SextTer19 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info  		C434(3.28)  LDD0304  [1]
DBIA
 Probe Info  		C434(2.24)  LDD3339  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0625  F8 Ramos C434(1.16)  LDD2187  [3]
 LDCM0572  Fragment10 Ramos C434(2.56)  LDD2189  [3]
 LDCM0573  Fragment11 Ramos C434(0.03)  LDD2190  [3]
 LDCM0574  Fragment12 Ramos C434(1.46)  LDD2191  [3]
 LDCM0575  Fragment13 Ramos C434(0.99)  LDD2192  [3]
 LDCM0576  Fragment14 Ramos C434(1.01)  LDD2193  [3]
 LDCM0579  Fragment20 Ramos C434(2.24)  LDD2194  [3]
 LDCM0580  Fragment21 Ramos C434(0.92)  LDD2195  [3]
 LDCM0582  Fragment23 Ramos C434(0.82)  LDD2196  [3]
 LDCM0578  Fragment27 Ramos C434(0.81)  LDD2197  [3]
 LDCM0586  Fragment28 Ramos C434(0.88)  LDD2198  [3]
 LDCM0588  Fragment30 Ramos C434(1.12)  LDD2199  [3]
 LDCM0589  Fragment31 Ramos C434(0.77)  LDD2200  [3]
 LDCM0590  Fragment32 Ramos C434(4.55)  LDD2201  [3]
 LDCM0468  Fragment33 Ramos C434(1.42)  LDD2202  [3]
 LDCM0596  Fragment38 Ramos C434(0.68)  LDD2203  [3]
 LDCM0566  Fragment4 Ramos C434(1.72)  LDD2184  [3]
 LDCM0610  Fragment52 Ramos C434(0.97)  LDD2204  [3]
 LDCM0614  Fragment56 Ramos C434(0.78)  LDD2205  [3]
 LDCM0569  Fragment7 Ramos C434(1.78)  LDD2186  [3]
 LDCM0571  Fragment9 Ramos C434(2.14)  LDD2188  [3]
 LDCM0022  KB02 T cell C434(7.17)  LDD1703  [4]
 LDCM0023  KB03 Ramos C434(1.55)  LDD2183  [3]
 LDCM0024  KB05 NALM-6 C434(2.24)  LDD3339  [2]
 LDCM0131  RA190 MM1.R C434(3.28)  LDD0304  [1]
 LDCM0170  Structure8 Ramos 20.00  LDD0433  [5]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 38 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 5'-AMP-activated protein kinase beta subunit family O43741
Maspardin (SPG21) AB hydrolase superfamily Q9NZD8
DNA-directed RNA polymerases I and III subunit RPAC1 (POLR1C) Archaeal Rpo3/eukaryotic RPB3 RNA polymerase subunit family O15160
Phenylalanine--tRNA ligase, mitochondrial (FARS2) Class-II aminoacyl-tRNA synthetase family O95363
Probable E3 ubiquitin-protein ligase DTX2 (DTX2) Deltex family Q86UW9
Peroxisomal bifunctional enzyme (EHHADH) Enoyl-CoA hydratase/isomerase family; 3-hydroxyacyl-CoA dehydrogenase family Q08426
Histone acetyltransferase KAT5 (KAT5) MYST (SAS/MOZ) family Q92993
Nucleoside diphosphate kinase homolog 7 (NME7) NDK family Q9Y5B8
Nitric oxide synthase 3 (NOS3) NOS family P29474
Tudor-interacting repair regulator protein (NUDT16L1) Nudix hydrolase family Q9BRJ7
Ubiquitin carboxyl-terminal hydrolase 2 (USP2) Peptidase C19 family O75604
AMSH-like protease (STAMBPL1) Peptidase M67C family Q96FJ0
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Serine/threonine-protein kinase N1 (PKN1) AGC Ser/Thr protein kinase family Q16512
Testis-specific serine/threonine-protein kinase 3 (TSSK3) CAMK Ser/Thr protein kinase family Q96PN8
5'-AMP-activated protein kinase catalytic subunit alpha-1 (PRKAA1) CAMK Ser/Thr protein kinase family Q13131
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2) CAMK Ser/Thr protein kinase family P54646
Cyclin-dependent kinase 18 (CDK18) CMGC Ser/Thr protein kinase family Q07002
Cyclin-dependent kinase 4 (CDK4) CMGC Ser/Thr protein kinase family P11802
Serine/threonine-protein kinase Nek6 (NEK6) NEK Ser/Thr protein kinase family Q9HC98
Serine/threonine-protein kinase 16 (STK16) Ser/Thr protein kinase family O75716
Cell division cycle 7-related protein kinase (CDC7) Ser/Thr protein kinase family O00311
Protein-tyrosine kinase 6 (PTK6) Tyr protein kinase family Q13882
Tyrosine-protein kinase Blk (BLK) Tyr protein kinase family P51451
Tyrosine-protein kinase Yes (YES1) Tyr protein kinase family P07947
Exosome complex component RRP46 (EXOSC5) RNase PH family Q9NQT4
GTP-binding protein GEM (GEM) RGK family P55040
Transforming protein RhoA (RHOA) Rho family P61586
Kinesin-like protein KIF9 (KIF9) Kinesin family Q9HAQ2
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
V-type proton ATPase subunit d 2 (ATP6V0D2) V-ATPase V0D/AC39 subunit family Q8N8Y2
E3 ubiquitin-protein ligase FANCL (FANCL) . Q9NW38
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
LON peptidase N-terminal domain and RING finger protein 1 (LONRF1) . Q17RB8
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (PIN1) . Q13526
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
Prolyl hydroxylase EGLN3 (EGLN3) . Q9H6Z9
Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2 (TSTD2) . Q5T7W7
Transporter and channel
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cation channel sperm-associated protein 1 (CATSPER1) Cation channel sperm-associated (TC 1.A.1.19) family Q8NEC5
Hsp90 co-chaperone Cdc37 (CDC37) CDC37 family Q16543
ER membrane protein complex subunit 2 (EMC2) EMC2 family Q15006
Exocyst complex component 8 (EXOC8) EXO84 family Q8IYI6
Aquaporin-1 (AQP1) MIP/aquaporin (TC 1.A.8) family P29972
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Transcription factor
Click To Hide/Show 13 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-C8 (HOXC8) Antp homeobox family P31273
Transcription factor AP-2-delta (TFAP2D) AP-2 family Q7Z6R9
REST corepressor 3 (RCOR3) CoREST family Q9P2K3
Zinc finger protein Aiolos (IKZF3) Ikaros C2H2-type zinc-finger protein family Q9UKT9
Zinc finger protein Pegasus (IKZF5) Ikaros C2H2-type zinc-finger protein family Q9H5V7
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein 587 (ZNF587) Krueppel C2H2-type zinc-finger protein family Q96SQ5
Zinc finger protein 76 (ZNF76) Krueppel C2H2-type zinc-finger protein family P36508
NF-kappa-B inhibitor delta (NFKBID) NF-kappa-B inhibitor family Q8NI38
Forkhead box protein P3 (FOXP3) . Q9BZS1
Golgin-45 (BLZF1) . Q9H2G9
Zinc finger CCCH-type with G patch domain-containing protein (ZGPAT) . Q8N5A5
Zinc finger MYM-type protein 2 (ZMYM2) . Q9UBW7
Other
Click To Hide/Show 66 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ATP synthase mitochondrial F1 complex assembly factor 2 (ATPAF2) ATP12 family Q8N5M1
Large ribosomal subunit protein bL28m (MRPL28) Bacterial ribosomal protein bL28 family Q13084
Beta-crystallin A4 (CRYBA4) Beta/gamma-crystallin family P53673
Bystin (BYSL) Bystin family Q13895
Cyclin-dependent kinase inhibitor 1 (CDKN1A) CDI family P38936
Cyclin-dependent kinase 4 inhibitor D (CDKN2D) CDKN2 cyclin-dependent kinase inhibitor family P55273
Cilia- and flagella-associated protein 206 (CFAP206) CFAP206 family Q8IYR0
Cyclin-dependent kinases regulatory subunit 1 (CKS1B) CKS family P61024
PCI domain-containing protein 2 (PCID2) CSN12 family Q5JVF3
Protein FAM50B (FAM50B) FAM50 family Q9Y247
Golgin subfamily A member 6A (GOLGA6A) GOLGA6 family Q9NYA3
Growth factor receptor-bound protein 2 (GRB2) GRB2/sem-5/DRK family P62993
Inhibitor of growth protein 5 (ING5) ING family Q8WYH8
Keratin, type I cytoskeletal 19 (KRT19) Intermediate filament family P08727
Protein mago nashi homolog 2 (MAGOHB) Mago nashi family Q96A72
Mitotic interactor and substrate of PLK1 (MISP) MISP family Q8IVT2
Large ribosomal subunit protein mL53 (MRPL53) Mitochondrion-specific ribosomal protein mL53 family Q96EL3
Protein NATD1 (NATD1) NATD1 family Q8N6N6
Ornithine decarboxylase antizyme 3 (OAZ3) ODC antizyme family Q9UMX2
Oxidative stress-induced growth inhibitor 1 (OSGIN1) OKL38 family Q9UJX0
Phosphatidylinositol 3-kinase regulatory subunit beta (PIK3R2) PI3K p85 subunit family O00459
Prefoldin subunit 3 (VBP1) Prefoldin subunit alpha family P61758
Prefoldin subunit 5 (PFDN5) Prefoldin subunit alpha family Q99471
Pre-mRNA-splicing factor 18 (PRPF18) PRP18 family Q99633
DNA repair protein RAD51 homolog 4 (RAD51D) RecA family O75771
tRNA-splicing endonuclease subunit Sen15 (TSEN15) SEN15 family Q8WW01
Heat shock protein beta-7 (HSPB7) Small heat shock protein (HSP20) family Q9UBY9
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (SMARCD1) SMARCD family Q96GM5
Pre-mRNA-splicing factor SPF27 (BCAS2) SPF27 family O75934
Syntaxin-11 (STX11) Syntaxin family O75558
TRPM8 channel-associated factor 1 (TCAF1) TCAF family Q9Y4C2
Trichoplein keratin filament-binding protein (TCHP) TCHP family Q9BT92
Tektin-3 (TEKT3) Tektin family Q9BXF9
Tektin-4 (TEKT4) Tektin family Q8WW24
Trafficking protein particle complex subunit 6A (TRAPPC6A) TRAPP small subunits family O75865
TLE family member 5 (TLE5) WD repeat Groucho/TLE family Q08117
Actin-binding LIM protein 3 (ABLIM3) . O94929
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
Armadillo repeat-containing protein 7 (ARMC7) . Q9H6L4
Calcium-binding protein 5 (CABP5) . Q9NP86
Cation channel sperm-associated targeting subunit tau (C2CD6) . Q53TS8
Coiled-coil domain-containing protein 102B (CCDC102B) . Q68D86
Coiled-coil domain-containing protein 24 (CCDC24) . Q8N4L8
Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 (CHCHD2) . Q9Y6H1
EF-hand domain-containing protein 1 (EFHC1) . Q5JVL4
Enkurin domain-containing protein 1 (ENKD1) . Q9H0I2
Fibroblast growth factor receptor substrate 3 (FRS3) . O43559
Four and a half LIM domains protein 3 (FHL3) . Q13643
Heterogeneous nuclear ribonucleoprotein F (HNRNPF) . P52597
Kelch-like protein 38 (KLHL38) . Q2WGJ6
KN motif and ankyrin repeat domain-containing protein 2 (KANK2) . Q63ZY3
Leukocyte receptor cluster member 1 (LENG1) . Q96BZ8
LIM domain transcription factor LMO4 (LMO4) . P61968
Microspherule protein 1 (MCRS1) . Q96EZ8
Mirror-image polydactyly gene 1 protein (MIPOL1) . Q8TD10
Mitotic spindle assembly checkpoint protein MAD2B (MAD2L2) . Q9UI95
MORN repeat-containing protein 3 (MORN3) . Q6PF18
Phostensin (PPP1R18) . Q6NYC8
Placental protein 13-like (LGALS14) . Q8TCE9
Protein phosphatase 1 regulatory inhibitor subunit 16B (PPP1R16B) . Q96T49
Rho guanine nucleotide exchange factor 6 (ARHGEF6) . Q15052
Rhombotin-1 (LMO1) . P25800
Rhombotin-2 (LMO2) . P25791
TBC1 domain family member 22B (TBC1D22B) . Q9NU19
Telethonin (TCAP) . O15273
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00

References

1 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
4 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.
5 2-Sulfonylpyridines as Tunable, Cysteine-Reactive Electrophiles. J Am Chem Soc. 2020 May 13;142(19):8972-8979. doi: 10.1021/jacs.0c02721. Epub 2020 Apr 29.