Details of the Target
General Information of Target
| Target ID | LDTP12911 | |||||
|---|---|---|---|---|---|---|
| Target Name | Adenosine deaminase 2 (ADA2) | |||||
| Gene Name | ADA2 | |||||
| Gene ID | 51816 | |||||
| Synonyms |
ADGF; CECR1; IDGFL; Adenosine deaminase 2; EC 3.5.4.4; Cat eye syndrome critical region protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPG
GAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWF KVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Metallo-dependent hydrolases superfamily, Adenosine and AMP deaminases family, ADGF subfamily
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Adenosine deaminase that may contribute to the degradation of extracellular adenosine, a signaling molecule that controls a variety of cellular responses. Requires elevated adenosine levels for optimal enzyme activity. Binds to cell surfaces via proteoglycans and may play a role in the regulation of cell proliferation and differentiation, independently of its enzyme activity.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| HCT15 | SNV: p.R294I | . | |||
| HT115 | SNV: p.K275N | . | |||
| KMCH1 | SNV: p.Y290D | . | |||
| KMRC1 | SNV: p.Y453H | . | |||
| LS123 | SNV: p.H332Q | . | |||
| MEWO | SNV: p.M465I | . | |||
| ONS76 | SNV: p.F14L | . | |||
| SW620 | SNV: p.Y220S | . | |||
| TF1 | SNV: p.V175I | DBIA Probe Info | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C408(2.15) | LDD3338 | [1] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0167 | [2] | |
|
Compound 10 Probe Info |
![]() |
N.A. | LDD2216 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0202 | EV-93 | T cell | C408(20.00) | LDD0527 | [4] |
| LDCM0625 | F8 | Ramos | C408(1.12) | LDD2187 | [5] |
| LDCM0572 | Fragment10 | Ramos | C408(1.35) | LDD2189 | [5] |
| LDCM0574 | Fragment12 | Ramos | C408(1.94) | LDD2191 | [5] |
| LDCM0575 | Fragment13 | Ramos | C408(1.89) | LDD2192 | [5] |
| LDCM0579 | Fragment20 | Ramos | C408(1.21) | LDD2194 | [5] |
| LDCM0580 | Fragment21 | Ramos | C408(1.71) | LDD2195 | [5] |
| LDCM0582 | Fragment23 | Ramos | C408(0.66) | LDD2196 | [5] |
| LDCM0578 | Fragment27 | Ramos | C408(0.90) | LDD2197 | [5] |
| LDCM0586 | Fragment28 | Ramos | C408(0.79) | LDD2198 | [5] |
| LDCM0588 | Fragment30 | Ramos | C408(1.49) | LDD2199 | [5] |
| LDCM0589 | Fragment31 | Ramos | C408(1.06) | LDD2200 | [5] |
| LDCM0468 | Fragment33 | Ramos | C408(2.28) | LDD2202 | [5] |
| LDCM0596 | Fragment38 | Ramos | C408(1.04) | LDD2203 | [5] |
| LDCM0614 | Fragment56 | Ramos | C408(0.82) | LDD2205 | [5] |
| LDCM0022 | KB02 | T cell | C408(20.00) | LDD1707 | [4] |
| LDCM0023 | KB03 | K052 | C408(2.07) | LDD2844 | [1] |
| LDCM0024 | KB05 | MV4-11 | C408(2.15) | LDD3338 | [1] |
References



