Details of the Target
General Information of Target
Target ID | LDTP12578 | |||||
---|---|---|---|---|---|---|
Target Name | Keratin, type II cuticular Hb4 (KRT84) | |||||
Gene Name | KRT84 | |||||
Gene ID | 3890 | |||||
Synonyms |
KRTHB4; Keratin, type II cuticular Hb4; Keratin-84; K84; Type II hair keratin Hb4; Type-II keratin Kb24 |
|||||
3D Structure | ||||||
Sequence |
MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSI
DQGAEDVVMAFSRSETEDRRQ |
|||||
Target Bioclass |
Other
|
|||||
Family |
Intermediate filament family
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
ONAyne Probe Info |
![]() |
K438(10.00) | LDD0274 | [1] | |
AZ-9 Probe Info |
![]() |
E473(0.78); D181(0.99); E187(0.98) | LDD2208 | [2] | |
SAHA-CA-4PAP Probe Info |
![]() |
N.A. | LDD0361 | [3] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0165 | [4] | |
HHS-465 Probe Info |
![]() |
K191(0.00); K182(0.00) | LDD2240 | [5] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STS-1 Probe Info |
![]() |
3.80 | LDD0136 | [6] | |
STS-2 Probe Info |
![]() |
1.00 | LDD0139 | [6] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0625 | F8 | Ramos | C477(0.80) | LDD2187 | [7] |
LDCM0573 | Fragment11 | Ramos | C477(2.08) | LDD2190 | [7] |
LDCM0574 | Fragment12 | Ramos | C477(0.91) | LDD2191 | [7] |
LDCM0575 | Fragment13 | Ramos | C477(1.33) | LDD2192 | [7] |
LDCM0576 | Fragment14 | Ramos | C477(0.60) | LDD2193 | [7] |
LDCM0580 | Fragment21 | Ramos | C477(1.07) | LDD2195 | [7] |
LDCM0582 | Fragment23 | Ramos | C477(0.84) | LDD2196 | [7] |
LDCM0578 | Fragment27 | Ramos | C477(0.66) | LDD2197 | [7] |
LDCM0586 | Fragment28 | Ramos | C477(0.64) | LDD2198 | [7] |
LDCM0588 | Fragment30 | Ramos | C477(1.02) | LDD2199 | [7] |
LDCM0589 | Fragment31 | Ramos | C477(1.19) | LDD2200 | [7] |
LDCM0590 | Fragment32 | Ramos | C477(2.62) | LDD2201 | [7] |
LDCM0468 | Fragment33 | Ramos | C477(1.28) | LDD2202 | [7] |
LDCM0596 | Fragment38 | Ramos | C477(0.67) | LDD2203 | [7] |
LDCM0566 | Fragment4 | Ramos | C477(1.14) | LDD2184 | [7] |
LDCM0610 | Fragment52 | Ramos | C477(0.56) | LDD2204 | [7] |
LDCM0614 | Fragment56 | Ramos | C477(0.50) | LDD2205 | [7] |
LDCM0569 | Fragment7 | Ramos | C477(1.64) | LDD2186 | [7] |
LDCM0022 | KB02 | Ramos | C477(0.37) | LDD2182 | [7] |
LDCM0023 | KB03 | Ramos | C477(0.41) | LDD2183 | [7] |
LDCM0024 | KB05 | Ramos | C477(0.32) | LDD2185 | [7] |
LDCM0096 | SAHA | K562 | N.A. | LDD0361 | [3] |
References