Details of the Target
General Information of Target
| Target ID | LDTP12578 | |||||
|---|---|---|---|---|---|---|
| Target Name | Keratin, type II cuticular Hb4 (KRT84) | |||||
| Gene Name | KRT84 | |||||
| Gene ID | 3890 | |||||
| Synonyms |
KRTHB4; Keratin, type II cuticular Hb4; Keratin-84; K84; Type II hair keratin Hb4; Type-II keratin Kb24 |
|||||
| 3D Structure | ||||||
| Sequence |
MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSI
DQGAEDVVMAFSRSETEDRRQ |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Intermediate filament family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
ONAyne Probe Info |
![]() |
K438(10.00) | LDD0274 | [1] | |
|
AZ-9 Probe Info |
![]() |
E473(0.78); D181(0.99); E187(0.98) | LDD2208 | [2] | |
|
SAHA-CA-4PAP Probe Info |
![]() |
N.A. | LDD0361 | [3] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0165 | [4] | |
|
HHS-465 Probe Info |
![]() |
K191(0.00); K182(0.00) | LDD2240 | [5] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STS-1 Probe Info |
![]() |
3.80 | LDD0136 | [6] | |
|
STS-2 Probe Info |
![]() |
1.00 | LDD0139 | [6] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C477(0.80) | LDD2187 | [7] |
| LDCM0573 | Fragment11 | Ramos | C477(2.08) | LDD2190 | [7] |
| LDCM0574 | Fragment12 | Ramos | C477(0.91) | LDD2191 | [7] |
| LDCM0575 | Fragment13 | Ramos | C477(1.33) | LDD2192 | [7] |
| LDCM0576 | Fragment14 | Ramos | C477(0.60) | LDD2193 | [7] |
| LDCM0580 | Fragment21 | Ramos | C477(1.07) | LDD2195 | [7] |
| LDCM0582 | Fragment23 | Ramos | C477(0.84) | LDD2196 | [7] |
| LDCM0578 | Fragment27 | Ramos | C477(0.66) | LDD2197 | [7] |
| LDCM0586 | Fragment28 | Ramos | C477(0.64) | LDD2198 | [7] |
| LDCM0588 | Fragment30 | Ramos | C477(1.02) | LDD2199 | [7] |
| LDCM0589 | Fragment31 | Ramos | C477(1.19) | LDD2200 | [7] |
| LDCM0590 | Fragment32 | Ramos | C477(2.62) | LDD2201 | [7] |
| LDCM0468 | Fragment33 | Ramos | C477(1.28) | LDD2202 | [7] |
| LDCM0596 | Fragment38 | Ramos | C477(0.67) | LDD2203 | [7] |
| LDCM0566 | Fragment4 | Ramos | C477(1.14) | LDD2184 | [7] |
| LDCM0610 | Fragment52 | Ramos | C477(0.56) | LDD2204 | [7] |
| LDCM0614 | Fragment56 | Ramos | C477(0.50) | LDD2205 | [7] |
| LDCM0569 | Fragment7 | Ramos | C477(1.64) | LDD2186 | [7] |
| LDCM0022 | KB02 | Ramos | C477(0.37) | LDD2182 | [7] |
| LDCM0023 | KB03 | Ramos | C477(0.41) | LDD2183 | [7] |
| LDCM0024 | KB05 | Ramos | C477(0.32) | LDD2185 | [7] |
| LDCM0096 | SAHA | K562 | N.A. | LDD0361 | [3] |
References







