Details of the Target

General Information of Target

Target ID LDTP12564
Target Name Tumor necrosis factor receptor superfamily member 19 (TNFRSF19)
Gene Name TNFRSF19
Gene ID 55504
Synonyms
TAJ; TROY; Tumor necrosis factor receptor superfamily member 19; TRADE; Toxicity and JNK inducer
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA
VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
Target Bioclass
Cytokine and receptor
Subcellular location
Membrane
Function Can mediate activation of JNK and NF-kappa-B. May promote caspase-independent cell death.
Uniprot ID
Q9NS68
Ensemble ID
ENST00000248484.9
HGNC ID
HGNC:11915

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C245(3.12)  LDD3430  [1]
NAIA_4
 Probe Info  		N.A.  LDD2226  [2]
TFBX
 Probe Info  		N.A.  LDD0027  [3]
W1
 Probe Info  		N.A.  LDD0236  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0284  AC24 HEK-293T C245(1.12)  LDD1523  [5]
 LDCM0293  AC32 HEK-293T C245(1.10)  LDD1532  [5]
 LDCM0302  AC40 HEK-293T C245(1.10)  LDD1541  [5]
 LDCM0310  AC48 HEK-293T C245(1.08)  LDD1549  [5]
 LDCM0319  AC56 HEK-293T C245(1.09)  LDD1558  [5]
 LDCM0328  AC64 HEK-293T C245(0.96)  LDD1567  [5]
 LDCM0345  AC8 HEK-293T C245(1.05)  LDD1569  [5]
 LDCM0275  AKOS034007705 HEK-293T C245(1.16)  LDD1514  [5]
 LDCM0371  CL102 HEK-293T C245(1.10)  LDD1575  [5]
 LDCM0375  CL106 HEK-293T C245(1.02)  LDD1579  [5]
 LDCM0380  CL110 HEK-293T C245(1.33)  LDD1584  [5]
 LDCM0384  CL114 HEK-293T C245(1.30)  LDD1588  [5]
 LDCM0388  CL118 HEK-293T C245(1.16)  LDD1592  [5]
 LDCM0390  CL12 HEK-293T C245(1.41)  LDD1594  [5]
 LDCM0393  CL122 HEK-293T C245(1.16)  LDD1597  [5]
 LDCM0397  CL126 HEK-293T C245(1.17)  LDD1601  [5]
 LDCM0401  CL14 HEK-293T C245(1.03)  LDD1605  [5]
 LDCM0407  CL2 HEK-293T C245(1.10)  LDD1611  [5]
 LDCM0412  CL24 HEK-293T C245(1.32)  LDD1616  [5]
 LDCM0414  CL26 HEK-293T C245(1.01)  LDD1618  [5]
 LDCM0425  CL36 HEK-293T C245(1.27)  LDD1629  [5]
 LDCM0438  CL48 HEK-293T C245(1.18)  LDD1642  [5]
 LDCM0441  CL50 HEK-293T C245(1.13)  LDD1645  [5]
 LDCM0452  CL60 HEK-293T C245(1.34)  LDD1655  [5]
 LDCM0454  CL62 HEK-293T C245(1.25)  LDD1657  [5]
 LDCM0465  CL72 HEK-293T C245(1.27)  LDD1668  [5]
 LDCM0467  CL74 HEK-293T C245(0.95)  LDD1670  [5]
 LDCM0478  CL84 HEK-293T C245(1.13)  LDD1681  [5]
 LDCM0480  CL86 HEK-293T C245(1.06)  LDD1683  [5]
 LDCM0491  CL96 HEK-293T C245(1.25)  LDD1694  [5]
 LDCM0493  CL98 HEK-293T C245(1.28)  LDD1696  [5]
 LDCM0427  Fragment51 HEK-293T C245(1.07)  LDD1631  [5]
 LDCM0022  KB02 A101D C245(1.66)  LDD2250  [1]
 LDCM0023  KB03 A101D C245(2.89)  LDD2667  [1]
 LDCM0024  KB05 SK-MEL-5 C245(3.12)  LDD3430  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
GTPase IMAP family member 5 (GIMAP5) AIG1/Toc34/Toc159-like paraseptin GTPase family Q96F15
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Prohibitin 1 (PHB1) Prohibitin family P35232
Other
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Maturin (MTURN) MTURN family Q8N3F0
Phosphatidylethanolamine-binding protein 1 (PEBP1) Phosphatidylethanolamine-binding protein family P30086
Rho GDP-dissociation inhibitor 1 (ARHGDIA) Rho GDI family P52565
Small glutamine-rich tetratricopeptide repeat-containing protein alpha (SGTA) SGT family O43765
Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB) SGT family Q96EQ0

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
3 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
4 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
5 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402