Details of the Target
General Information of Target
Target ID | LDTP12456 | |||||
---|---|---|---|---|---|---|
Target Name | Ectonucleoside triphosphate diphosphohydrolase 7 (ENTPD7) | |||||
Gene Name | ENTPD7 | |||||
Gene ID | 57089 | |||||
Synonyms |
LALP1; Ectonucleoside triphosphate diphosphohydrolase 7; NTPDase 7; EC 3.6.1.15; Lysosomal apyrase-like protein 1 |
|||||
3D Structure | ||||||
Sequence |
MADEQEIMCKLESIKEIRNKTLQMEKIKARLKAEFEALESEERHLKEYKQEMDLLLQEKM
AHVEELRLIHADINVMENTIKQSENDLNKLLESTRRLHDEYKPLKEHVDALRMTLGLQRL PDLCEEEEKLSLDYFEKQKAEWQTEPQEPPIPESLAAAAAAAQQLQVARKQDTRQTATFR QQPPPMKACLSCHQQIHRNAPICPLCKAKSRSRNPKKPKRKQDE |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
GDA1/CD39 NTPase family
|
|||||
Subcellular location |
Cytoplasmic vesicle membrane
|
|||||
Function |
Catalyzes the hydrolysis of nucleoside triphosphates and diphosphates in a calcium- or magnesium-dependent manner. Preferentially hydrolyzes nucleoside 5'-triphosphates, with substrate preference for UTP > GTP > CTP. Hydrolyzes ATP and nucleoside diphosphates only to a minor extent.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C296(1.08) | LDD1514 | [1] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
OEA-DA Probe Info |
![]() |
20.00 | LDD0046 | [2] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0284 | AC24 | HEK-293T | C296(1.03) | LDD1523 | [1] |
LDCM0293 | AC32 | HEK-293T | C296(1.01) | LDD1532 | [1] |
LDCM0302 | AC40 | HEK-293T | C296(1.07) | LDD1541 | [1] |
LDCM0310 | AC48 | HEK-293T | C296(1.14) | LDD1549 | [1] |
LDCM0319 | AC56 | HEK-293T | C296(1.02) | LDD1558 | [1] |
LDCM0328 | AC64 | HEK-293T | C296(1.00) | LDD1567 | [1] |
LDCM0345 | AC8 | HEK-293T | C296(0.94) | LDD1569 | [1] |
LDCM0275 | AKOS034007705 | HEK-293T | C296(1.08) | LDD1514 | [1] |
LDCM0390 | CL12 | HEK-293T | C296(1.11) | LDD1594 | [1] |
LDCM0412 | CL24 | HEK-293T | C296(1.05) | LDD1616 | [1] |
LDCM0425 | CL36 | HEK-293T | C296(1.19) | LDD1629 | [1] |
LDCM0438 | CL48 | HEK-293T | C296(1.19) | LDD1642 | [1] |
LDCM0452 | CL60 | HEK-293T | C296(1.14) | LDD1655 | [1] |
LDCM0465 | CL72 | HEK-293T | C296(0.92) | LDD1668 | [1] |
LDCM0478 | CL84 | HEK-293T | C296(1.18) | LDD1681 | [1] |
LDCM0491 | CL96 | HEK-293T | C296(1.26) | LDD1694 | [1] |
References