Details of the Target

General Information of Target

Target ID LDTP12309
Target Name High mobility group protein 20A (HMG20A)
Gene Name HMG20A
Gene ID 10363
Synonyms
HMGX1; HMGXB1; High mobility group protein 20A; HMG box-containing protein 20A; HMG domain-containing protein 1; HMG domain-containing protein HMGX1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEI
VDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTG
QKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTR
NPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAKKKKKKKKHKKKHK
E
Target Bioclass
Transcription factor
Subcellular location
Nucleus
Function
Plays a role in neuronal differentiation as chromatin-associated protein. Acts as inhibitor of HMG20B. Overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. Involved in the recruitment of the histone methyltransferase KMT2A/MLL1 and consequent increased methylation of histone H3 lysine 4.
Uniprot ID
Q9NP66
Ensemble ID
ENST00000336216.9
HGNC ID
HGNC:5001

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
AN3CA SNV: p.H202R .
COLO792 SNV: p.P37S .
HEC1B SNV: p.S229I .
HT SNV: p.T183P .
HT115 SNV: p.R112W .
SW403 SNV: p.E148Ter .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
Acrolein
 Probe Info  		H321(0.00); H284(0.00)  LDD0225  [1]
m-APA
 Probe Info  		N.A.  LDD2231  [2]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C003
 Probe Info  		12.13  LDD1713  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0109  NEM HeLa H321(0.00); H284(0.00)  LDD0225  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Anterior gradient protein 2 homolog (AGR2) AGR family O95994
Histone-lysine N-methyltransferase SMYD1 (SMYD1) Class V-like SAM-binding methyltransferase superfamily Q8NB12
Glutamine--tRNA ligase (QARS1) Class-I aminoacyl-tRNA synthetase family P47897
Dystrobrevin beta (DTNB) Dystrophin family O60941
Peroxisomal bifunctional enzyme (EHHADH) Enoyl-CoA hydratase/isomerase family; 3-hydroxyacyl-CoA dehydrogenase family Q08426
Ribonuclease P protein subunit p30 (RPP30) Eukaryotic/archaeal RNase P protein component 3 family P78346
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
Proteasome subunit beta type-1 (PSMB1) Peptidase T1B family P20618
Helicase ARIP4 (RAD54L2) SNF2/RAD54 helicase family Q9Y4B4
TNF receptor-associated factor 4 (TRAF4) TNF receptor-associated factor family Q9BUZ4
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Sulfite oxidase, mitochondrial (SUOX) . P51687
Transporter and channel
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Proton-coupled zinc antiporter SLC30A8 (SLC30A8) Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family Q8IWU4
Huntingtin (HTT) Huntingtin family P42858
Importin subunit alpha-1 (KPNA2) Importin alpha family P52292
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Synaptotagmin-like protein 4 (SYTL4) . Q96C24
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Transcription regulator protein BACH2 (BACH2) BZIP family Q9BYV9
Forkhead box protein D4-like 1 (FOXD4L1) . Q9NU39
High mobility group protein 20A (HMG20A) . Q9NP66
Oligodendrocyte transcription factor 3 (OLIG3) . Q7RTU3
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related (HMG20B) . Q9P0W2
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Parathyroid hormone 2 receptor (PTH2R) G-protein coupled receptor 2 family P49190
Other
Click To Hide/Show 27 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Bystin (BYSL) Bystin family Q13895
Calcineurin B homologous protein 3 (TESC) Calcineurin regulatory subunit family Q96BS2
Cilia- and flagella-associated protein 53 (CFAP53) CFAP53 family Q96M91
Cancer/testis antigen 1 (CTAG1A; CTAG1B) CTAG/PCC1 family P78358
DNA damage-inducible transcript 4-like protein (DDIT4L) DDIT4 family Q96D03
Radial spoke head protein 9 homolog (RSPH9) Flagellar radial spoke RSP9 family Q9H1X1
Protein DGCR6L (DGCR6L) Gonadal family Q9BY27
Keratin, type II cytoskeletal 1 (KRT1) Intermediate filament family P04264
Protein mago nashi homolog 2 (MAGOHB) Mago nashi family Q96A72
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
Large ribosomal subunit protein mL64 (GADD45GIP1) Mitochondrion-specific ribosomal protein mL64 family Q8TAE8
Hippocalcin-like protein 1 (HPCAL1) Recoverin family P37235
Ras and Rab interactor 1 (RIN1) RIN (Ras interaction/interference) family Q13671
Trichoplein keratin filament-binding protein (TCHP) TCHP family Q9BT92
T-complex protein 11-like protein 1 (TCP11L1) TCP11 family Q9NUJ3
Trafficking protein particle complex subunit 5 (TRAPPC5) TRAPP small subunits family Q8IUR0
Regulation of nuclear pre-mRNA domain-containing protein 1B (RPRD1B) UPF0400 (RTT103) family Q9NQG5
AP-4 complex accessory subunit RUSC1 (RUSC1) . Q9BVN2
Centrosomal protein of 95 kDa (CEP95) . Q96GE4
Coiled-coil domain-containing protein 6 (CCDC6) . Q16204
Guanine nucleotide exchange factor C9orf72 (C9orf72) . Q96LT7
Leucine rich adaptor protein 1 (LURAP1) . Q96LR2
Nuclear transport factor 2 (NUTF2) . P61970
PRKCA-binding protein (PICK1) . Q9NRD5
Psoriasis susceptibility 1 candidate gene 2 protein (PSORS1C2) . Q9UIG4
Rhombotin-1 (LMO1) . P25800
TBC1 domain family member 22B (TBC1D22B) . Q9NU19

References

1 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
2 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
3 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587