Details of the Target
General Information of Target
| Target ID | LDTP12122 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ubiquitin domain-containing protein 1 (UBTD1) | |||||
| Gene Name | UBTD1 | |||||
| Gene ID | 80019 | |||||
| Synonyms |
Ubiquitin domain-containing protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MLATLARVAALRRTCLFSGRGGGRGLWTGRPQSDMNNIKPLEGVKILDLTRVLAGPFATM
NLGDLGAEVIKVERPGAGDDTRTWGPPFVGTESTYYLSVNRNKKSIAVNIKDPKGVKIIK ELAAVCDVFVENYVPGKLSAMGLGYEDIDEIAPHIIYCSITGYGQTGPISQRAGYDAVAS AVSGLMHITGPENGDPVRPGVAMTDLATGLYAYGAIMAGLIQKYKTGKGLFIDCNLLSSQ VACLSHIAANYLIGQKEAKRWGTAHGSIVPYQAFKTKDGYIVVGAGNNQQFATVCKILDL PELIDNSKYKTNHLRVHNRKELIKILSERFEEELTSKWLYLFEGSGVPYGPINNMKNVFA EPQVLHNGLVMEMEHPTVGKISVPGPAVRYSKFKMSEARPPPLLGQHTTHILKEVLRYDD RAIGELLSAGVVDQHETH |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Function |
May be involved in the regulation of cellular senescence through a positive feedback loop with TP53. Is a TP53 downstream target gene that increases the stability of TP53 protein by promoting the ubiquitination and degradation of MDM2.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K152(5.56) | LDD0277 | [1] | |
|
AHL-Pu-1 Probe Info |
![]() |
C103(3.84) | LDD0171 | [2] | |
|
DBIA Probe Info |
![]() |
C103(1.06) | LDD1512 | [3] | |
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [4] | |
|
AOyne Probe Info |
![]() |
14.50 | LDD0443 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0026 | 4SU-RNA+native RNA | DM93 | C103(3.84) | LDD0171 | [2] |
| LDCM0259 | AC14 | HEK-293T | C103(1.06) | LDD1512 | [3] |
| LDCM0282 | AC22 | HEK-293T | C103(0.99) | LDD1521 | [3] |
| LDCM0291 | AC30 | HEK-293T | C103(0.98) | LDD1530 | [3] |
| LDCM0299 | AC38 | HEK-293T | C103(0.81) | LDD1538 | [3] |
| LDCM0308 | AC46 | HEK-293T | C103(0.84) | LDD1547 | [3] |
| LDCM0317 | AC54 | HEK-293T | C103(0.81) | LDD1556 | [3] |
| LDCM0323 | AC6 | HEK-293T | C103(0.91) | LDD1562 | [3] |
| LDCM0326 | AC62 | HEK-293T | C103(0.82) | LDD1565 | [3] |
| LDCM0368 | CL10 | HEK-293T | C103(1.07) | LDD1572 | [3] |
| LDCM0410 | CL22 | HEK-293T | C103(0.83) | LDD1614 | [3] |
| LDCM0423 | CL34 | HEK-293T | C103(0.89) | LDD1627 | [3] |
| LDCM0436 | CL46 | HEK-293T | C103(0.81) | LDD1640 | [3] |
| LDCM0449 | CL58 | HEK-293T | C103(0.73) | LDD1652 | [3] |
| LDCM0463 | CL70 | HEK-293T | C103(0.66) | LDD1666 | [3] |
| LDCM0476 | CL82 | HEK-293T | C103(0.93) | LDD1679 | [3] |
| LDCM0489 | CL94 | HEK-293T | C103(0.89) | LDD1692 | [3] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Other
References





