Details of the Target

General Information of Target

Target ID LDTP12118
Target Name Ceramide synthase 4 (CERS4)
Gene Name CERS4
Gene ID 79603
Synonyms
LASS4; Ceramide synthase 4; CerS4; EC 2.3.1.-; LAG1 longevity assurance homolog 4; Sphingosine N-acyltransferase CERS4; EC 2.3.1.24
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEGAGYRVVFEKGGVYLHTSAKKYQDRDSLIAGVIRVVEKDNDVLLHWAPVEEAGDSTQI
LFSKKDSSGGDSCASEEEPTFDPGYEPDWAVISTVRPQLCHSEPTRGAEPSCPQGSWAFS
VSLGELKSIRRSKPGLSWAYLVLVTQAGGSLPALHFHRGGTRALLRVLSRYLLLASSPQD
SRLYLVFPHDSSALSNSFHHLQLFDQDSSNVVSRFLQDPYSTTFSSFSRVTNFFRGALQP
QPEGAASDLPPPPDDEPEPGFEVISCVELGPRPTVERGPPVTEEEWARHVGPEGRLQQVP
ELKNRIFSGGLSPSLRREAWKFLLGYLSWEGTAEEHKAHIRKKTDEYFRMKLQWKSVSPE
QERRNSLLHGYRSLIERDVSRTDRTNKFYEGPENPGLGLLNDILLTYCMYHFDLGYVQGM
SDLLSPILYVIQNEVDAFWCFCGFMELVQGNFEESQETMKRQLGRLLLLLRVLDPLLCDF
LDSQDSGSLCFCFRWLLIWFKREFPFPDVLRLWEVLWTGLPGPNLHLLVACAILDMERDT
LMLSGFGSNEILKHINELTMKLSVEDVLTRAEALHRQLTACPELPHNVQEILGLAPPAEP
HSPSPTASPLPLSPTRAPPTPPPSTDTAPQPDSSLEILPEEEDEGADS
Target Bioclass
Enzyme
Subcellular location
Endoplasmic reticulum membrane
Function Ceramide synthase that catalyzes formation of ceramide from sphinganine and acyl-CoA substrates, with high selectivity toward long and very-long chains (C18:0-C22:0) as acyl donor.
Uniprot ID
Q9HA82
Ensemble ID
ENST00000251363.10
HGNC ID
HGNC:23747

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		N.A.  LDD0241  [1]
DBIA
 Probe Info  		C107(1.83)  LDD3468  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0284  AC24 HEK-293T C107(1.46)  LDD1523  [3]
 LDCM0293  AC32 HEK-293T C107(1.26)  LDD1532  [3]
 LDCM0302  AC40 HEK-293T C107(1.08)  LDD1541  [3]
 LDCM0310  AC48 HEK-293T C107(1.18)  LDD1549  [3]
 LDCM0319  AC56 HEK-293T C107(0.98)  LDD1558  [3]
 LDCM0328  AC64 HEK-293T C107(1.10)  LDD1567  [3]
 LDCM0345  AC8 HEK-293T C107(1.03)  LDD1569  [3]
 LDCM0275  AKOS034007705 HEK-293T C107(1.44)  LDD1514  [3]
 LDCM0390  CL12 HEK-293T C107(1.08)  LDD1594  [3]
 LDCM0412  CL24 HEK-293T C107(1.20)  LDD1616  [3]
 LDCM0425  CL36 HEK-293T C107(1.26)  LDD1629  [3]
 LDCM0438  CL48 HEK-293T C107(1.23)  LDD1642  [3]
 LDCM0452  CL60 HEK-293T C107(1.28)  LDD1655  [3]
 LDCM0465  CL72 HEK-293T C107(1.06)  LDD1668  [3]
 LDCM0478  CL84 HEK-293T C107(1.45)  LDD1681  [3]
 LDCM0491  CL96 HEK-293T C107(1.23)  LDD1694  [3]
 LDCM0022  KB02 KYSE-150 C107(1.08)  LDD2434  [2]
 LDCM0023  KB03 KYSE-150 C107(1.36)  LDD2851  [2]
 LDCM0024  KB05 TE-11 C107(1.83)  LDD3468  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Inactive pancreatic lipase-related protein 1 (PNLIPRP1) Lipase family P54315
N-acetyltransferase 8 (NAT8) Camello family Q9UHE5
Stearoyl-CoA desaturase (SCD) Fatty acid desaturase type 1 family O00767
NADH-cytochrome b5 reductase 3 (CYB5R3) Flavoprotein pyridine nucleotide cytochrome reductase family P00387
Sialidase-1 (NEU1) Glycosyl hydrolase 33 family Q99519
Tyrosine-protein phosphatase non-receptor type 9 (PTPN9) Protein-tyrosine phosphatase family P43378
Transporter and channel
Click To Hide/Show 14 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
High affinity cationic amino acid transporter 1 (SLC7A1) Cationic amino acid transporter (CAT) (TC 2.A.3.3) family P30825
FXYD domain-containing ion transport regulator 6 (FXYD6) FXYD family Q9H0Q3
LHFPL tetraspan subfamily member 5 protein (LHFPL5) LHFP family Q8TAF8
B-lymphocyte antigen CD20 (MS4A1) MS4A family P11836
CMP-sialic acid transporter (SLC35A1) Nucleotide-sugar transporter family P78382
Secretory carrier-associated membrane protein 5 (SCAMP5) SCAMP family Q8TAC9
Solute carrier family 13 member 4 (SLC13A4) SLC13A/DASS transporter family Q9UKG4
Solute carrier family 35 member F6 (SLC35F6) SLC35F solute transporter family Q8N357
Vesicle-associated membrane protein 2 (VAMP2) Synaptobrevin family P63027
Uroplakin-1b (UPK1B) Tetraspanin (TM4SF) family O75841
Transmembrane protein 176A (TMEM176A) TMEM176 family Q96HP8
Translocator protein 2 (TSPO2) TspO/BZRP family Q5TGU0
Proteolipid protein 2 (PLP2) . Q04941
Transmembrane protein 72 (TMEM72) . A0PK05
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
G-protein coupled receptor 151 (GPR151) G-protein coupled receptor 1 family Q8TDV0
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
C-C motif chemokine 4-like (CCL4L1; CCL4L2) Intercrine beta (chemokine CC) family Q8NHW4
Other
Click To Hide/Show 17 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cortexin-3 (CTXN3) Cortexin family Q4LDR2
Integrin alpha-M (ITGAM) Integrin alpha chain family P11215
Protein jagunal homolog 1 (JAGN1) Jagunal family Q8N5M9
Stress-associated endoplasmic reticulum protein 2 (SERP2) RAMP4 family Q8N6R1
Small EDRK-rich factor 1 (SERF1A; SERF1B) SERF family O75920
Syntaxin-7 (STX7) Syntaxin family O15400
Syntaxin-8 (STX8) Syntaxin family Q9UNK0
Mitochondrial import receptor subunit TOM6 homolog (TOMM6) Tom6 family Q96B49
Immediate early response 3-interacting protein 1 (IER3IP1) YOS1 family Q9Y5U9
C-type lectin domain family 1 member A (CLEC1A) . Q8NC01
Complement C1q-like protein 4 (C1QL4) . Q86Z23
Emerin (EMD) . P50402
Fetal and adult testis-expressed transcript protein (FATE1) . Q969F0
Insulin-like growth factor-binding protein 5 (IGFBP5) . P24593
Small integral membrane protein 11 (SMIM11) . P58511
Testis-expressed protein 264 (TEX264) . Q9Y6I9
Transmembrane protein 254 (TMEM254) . Q8TBM7

References

1 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402