Details of the Target

General Information of Target

Target ID LDTP11686
Target Name Ras-related protein Rab-33B (RAB33B)
Gene Name RAB33B
Gene ID 83452
Synonyms
Ras-related protein Rab-33B
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSVDPMTYEAQFFGFTPQTCMLRIYIAFQDYLFEVMQAVEQVILKKLDGIPDCDISPVQI
RKCTEKFLCFMKGHFDNLFSKMEQLFLQLILRIPSNILLPEDKCKETPYSEEDFQHLQKE
IEQLQEKYKTELCTKQALLAELEEQKIVQAKLKQTLTFFDELHNVGRDHGTSDFRESLVS
LVQNSRKLQNIRDNVEKESKRLKIS
Target Bioclass
Enzyme
Family
Small GTPase superfamily, Rab family
Subcellular location
Golgi apparatus membrane
Function Protein transport. Acts, in coordination with RAB6A, to regulate intra-Golgi retrograde trafficking. It is involved in autophagy, acting as a modulator of autophagosome formation.
Uniprot ID
Q9H082
Ensemble ID
ENST00000305626.6
HGNC ID
HGNC:16075

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C48(3.64)  LDD3331  [1]
BTD
 Probe Info  		C150(1.62)  LDD1700  [2]
IA-alkyne
 Probe Info  		C150(0.81)  LDD2185  [3]
IPM
 Probe Info  		N.A.  LDD0025  [4]
JW-RF-010
 Probe Info  		N.A.  LDD0026  [4]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [5]
AOyne
 Probe Info  		12.50  LDD0443  [6]
NAIA_5
 Probe Info  		N.A.  LDD2223  [7]
PAL-AfBPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STS-2
 Probe Info  		N.A.  LDD0138  [8]
DFG-out-4
 Probe Info  		4.30  LDD0075  [9]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C150(0.71)  LDD2117  [2]
 LDCM0558  2-Cyano-N-phenylacetamide MDA-MB-231 C150(1.20)  LDD2152  [2]
 LDCM0259  AC14 HEK-293T C132(1.10)  LDD1512  [10]
 LDCM0282  AC22 HEK-293T C132(1.04)  LDD1521  [10]
 LDCM0291  AC30 HEK-293T C132(1.09)  LDD1530  [10]
 LDCM0299  AC38 HEK-293T C132(1.04)  LDD1538  [10]
 LDCM0308  AC46 HEK-293T C132(0.98)  LDD1547  [10]
 LDCM0317  AC54 HEK-293T C132(0.94)  LDD1556  [10]
 LDCM0323  AC6 HEK-293T C132(0.86)  LDD1562  [10]
 LDCM0326  AC62 HEK-293T C132(0.96)  LDD1565  [10]
 LDCM0632  CL-Sc Hep-G2 C150(0.39)  LDD2227  [7]
 LDCM0368  CL10 HEK-293T C132(1.04)  LDD1572  [10]
 LDCM0410  CL22 HEK-293T C132(0.99)  LDD1614  [10]
 LDCM0423  CL34 HEK-293T C132(1.04)  LDD1627  [10]
 LDCM0436  CL46 HEK-293T C132(0.96)  LDD1640  [10]
 LDCM0449  CL58 HEK-293T C132(0.96)  LDD1652  [10]
 LDCM0463  CL70 HEK-293T C132(1.06)  LDD1666  [10]
 LDCM0476  CL82 HEK-293T C132(0.91)  LDD1679  [10]
 LDCM0489  CL94 HEK-293T C132(0.89)  LDD1692  [10]
 LDCM0017  DFG-out-2 A431 4.30  LDD0075  [9]
 LDCM0625  F8 Ramos C150(0.63)  LDD2187  [3]
 LDCM0573  Fragment11 Ramos C150(1.20)  LDD2190  [3]
 LDCM0586  Fragment28 Ramos C150(0.91)  LDD2198  [3]
 LDCM0569  Fragment7 Ramos C150(0.61)  LDD2186  [3]
 LDCM0022  KB02 CAL-78 C48(1.68)  LDD2291  [1]
 LDCM0023  KB03 MDA-MB-231 C48(0.56)  LDD1701  [2]
 LDCM0024  KB05 MKN-1 C48(3.64)  LDD3331  [1]
 LDCM0500  Nucleophilic fragment 13a MDA-MB-231 C150(0.49)  LDD2093  [2]
 LDCM0506  Nucleophilic fragment 16a MDA-MB-231 C150(0.72)  LDD2099  [2]
 LDCM0514  Nucleophilic fragment 20a MDA-MB-231 C150(0.79)  LDD2107  [2]
 LDCM0516  Nucleophilic fragment 21a MDA-MB-231 C150(0.69)  LDD2109  [2]
 LDCM0526  Nucleophilic fragment 26a MDA-MB-231 C150(0.87)  LDD2119  [2]
 LDCM0532  Nucleophilic fragment 29a MDA-MB-231 C150(0.53)  LDD2125  [2]
 LDCM0536  Nucleophilic fragment 31 MDA-MB-231 C150(0.80)  LDD2129  [2]
 LDCM0542  Nucleophilic fragment 37 MDA-MB-231 C150(0.58)  LDD2135  [2]
 LDCM0544  Nucleophilic fragment 39 MDA-MB-231 C150(0.61)  LDD2137  [2]
 LDCM0211  Nucleophilic fragment 3b MDA-MB-231 C150(1.62)  LDD1700  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Autophagy-related protein 16-1 (ATG16L1) WD repeat ATG16 family Q676U5

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
3 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
4 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
5 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
6 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
7 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
8 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.
9 Affinity-based probes based on type II kinase inhibitors. J Am Chem Soc. 2012 Nov 21;134(46):19017-25. doi: 10.1021/ja306035v. Epub 2012 Nov 6.
10 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402