Details of the Target
General Information of Target
| Target ID | LDTP11303 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein TALPID3 (KIAA0586) | |||||
| Gene Name | KIAA0586 | |||||
| Gene ID | 9786 | |||||
| Synonyms |
TALPID3; Protein TALPID3 |
|||||
| 3D Structure | ||||||
| Sequence |
MSTHVAGLGLDKMKLGNPQSFLDQEEADDQQLLEPEAWKTYTERRNALREFLTSDLSPHL
LKRHHARMQLLRKCSYYIEVLPKHLALGDQNPLVLPSALFQLIDPWKFQRMKKVGTAQTK IQLLLLGDLLEQLDHGRAELDALLRSPDPRPFLADWALVERRLADVSAVMDSFLTMMVPG RLHVKHRLVSDVSATKIPHIWLMLSTKMPVVFDRKASAAHQDWARLRWFVTIQPATSEQY ELRFRLLDPRTQQECAQCGVIPVAACTFDVRNLLPNRSYKFTIKRAETSTLVYEPWRDSL TLHTKPEPLEGPALSHSV |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
TALPID3 family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome
|
|||||
| Function |
Required for ciliogenesis and sonic hedgehog/SHH signaling. Required for the centrosomal recruitment of RAB8A and for the targeting of centriole satellite proteins to centrosomes such as of PCM1. May play a role in early ciliogenesis in the disappearance of centriolar satellites that preceeds ciliary vesicle formation. Involved in regulation of cell intracellular organization. Involved in regulation of cell polarity. Required for asymmetrical localization of CEP120 to daughter centrioles.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K474(6.25) | LDD0277 | [1] | |
|
DBIA Probe Info |
![]() |
C225(1.03) | LDD1514 | [2] | |
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0284 | AC24 | HEK-293T | C225(0.86) | LDD1523 | [2] |
| LDCM0293 | AC32 | HEK-293T | C225(0.97) | LDD1532 | [2] |
| LDCM0302 | AC40 | HEK-293T | C225(1.12) | LDD1541 | [2] |
| LDCM0310 | AC48 | HEK-293T | C225(1.06) | LDD1549 | [2] |
| LDCM0319 | AC56 | HEK-293T | C225(0.99) | LDD1558 | [2] |
| LDCM0328 | AC64 | HEK-293T | C225(1.09) | LDD1567 | [2] |
| LDCM0345 | AC8 | HEK-293T | C225(1.06) | LDD1569 | [2] |
| LDCM0275 | AKOS034007705 | HEK-293T | C225(1.03) | LDD1514 | [2] |
| LDCM0390 | CL12 | HEK-293T | C225(1.05) | LDD1594 | [2] |
| LDCM0412 | CL24 | HEK-293T | C225(1.16) | LDD1616 | [2] |
| LDCM0425 | CL36 | HEK-293T | C225(0.97) | LDD1629 | [2] |
| LDCM0438 | CL48 | HEK-293T | C225(1.06) | LDD1642 | [2] |
| LDCM0452 | CL60 | HEK-293T | C225(1.09) | LDD1655 | [2] |
| LDCM0465 | CL72 | HEK-293T | C225(1.17) | LDD1668 | [2] |
| LDCM0478 | CL84 | HEK-293T | C225(0.99) | LDD1681 | [2] |
| LDCM0491 | CL96 | HEK-293T | C225(1.08) | LDD1694 | [2] |
References



