Details of the Target

General Information of Target

Target ID LDTP10389
Target Name Transmembrane protein 19 (TMEM19)
Gene Name TMEM19
Gene ID 55266
Synonyms
Transmembrane protein 19
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRL
PNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQ
VKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKND
DDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLK
DSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC
Target Bioclass
Other
Family
TMEM19 family
Subcellular location
Membrane
Uniprot ID
Q96HH6
Ensemble ID
ENST00000266673.10
HGNC ID
HGNC:25605

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
NCIH2172 SNV: p.I88M .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K114(1.04)  LDD0277  [1]
TFBX
 Probe Info  		N.A.  LDD0027  [2]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C362
 Probe Info  		27.67  LDD2023  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Very long chain fatty acid elongase 4 (ELOVL4) ELO family Q9GZR5
Probable glutathione peroxidase 8 (GPX8) Glutathione peroxidase family Q8TED1
Prostaglandin E synthase (PTGES) MAPEG family O14684
Phosphatidylinositol N-acetylglucosaminyltransferase subunit P (PIGP) PIGP family P57054
17-beta-hydroxysteroid dehydrogenase 13 (HSD17B13) Short-chain dehydrogenases/reductases (SDR) family Q7Z5P4
TLC domain-containing protein 4 (TLCD4) TLCD4 family Q96MV1
E3 ubiquitin-protein ligase RNF185 (RNF185) . Q96GF1
Transporter and channel
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
High affinity cationic amino acid transporter 1 (SLC7A1) Cationic amino acid transporter (CAT) (TC 2.A.3.3) family P30825
Gap junction beta-1 protein (GJB1) Connexin family P08034
Membrane-associated progesterone receptor component 2 (PGRMC2) Cytochrome b5 family O15173
Hippocampus abundant transcript-like protein 1 (MFSD14B) Major facilitator superfamily Q5SR56
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Seipin (BSCL2) Seipin family Q96G97
Transmembrane protein 14B (TMEM14B) TMEM14 family Q9NUH8
Transmembrane protein 139 (TMEM139) . Q8IV31
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) BZIP family Q96BA8
GPCR
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cannabinoid receptor 2 (CNR2) G-protein coupled receptor 1 family P34972
G-protein coupled receptor 42 (GPR42) G-protein coupled receptor 1 family O15529
G-protein coupled receptor family C group 5 member D (GPRC5D) G-protein coupled receptor 3 family Q9NZD1
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
B-cell antigen receptor complex-associated protein alpha chain (CD79A) . P11912
Other
Click To Hide/Show 14 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Apolipoprotein A-V (APOA5) Apolipoprotein A1/A4/E family Q6Q788
Complexin-4 (CPLX4) Complexin/synaphin family Q7Z7G2
Receptor expression-enhancing protein 4 (REEP4) DP1 family Q9H6H4
Protein FAM210B, mitochondrial (FAM210B) FAM210 family Q96KR6
RAB6-interacting golgin (GORAB) GORAB family Q5T7V8
Lipid droplet assembly factor 1 (LDAF1) LDAF1 family Q96B96
Leptin receptor overlapping transcript-like 1 (LEPROTL1) OB-RGRP/VPS55 family O95214
Transmembrane protein 45A (TMEM45A) TMEM45 family Q9NWC5
Lymphocyte antigen 6E (LY6E) . Q16553
Protein KASH5 (KASH5) . Q8N6L0
Serine-rich and transmembrane domain-containing protein 1 (SERTM1) . A2A2V5
Sushi domain-containing protein 6 (SUSD6) . Q92537
T-cell surface glycoprotein CD3 gamma chain (CD3G) . P09693
Testis-expressed protein 29 (TEX29) . Q8N6K0

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
3 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587