Details of the Target

General Information of Target

Target ID LDTP10291
Target Name GTPase IMAP family member 5 (GIMAP5)
Gene Name GIMAP5
Gene ID 55340
Synonyms
IAN4L1; IAN5; IMAP3; GTPase IMAP family member 5; Immune-associated nucleotide-binding protein 5; Immunity-associated nucleotide 4-like 1 protein; Immunity-associated nucleotide 5 protein; IAN-5; hIAN5; Immunity-associated protein 3
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEIL
PAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDK
GCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK
Target Bioclass
Enzyme
Family
TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, AIG1/Toc34/Toc159-like paraseptin GTPase family, IAN subfamily
Subcellular location
Lysosome membrane
Function
Plays a role in T lymphocyte development and the optimal generation of CD4/CD8 double-positive thymocytes. Inhibitor of GSK3A, possibly by sequestering GSK3A in cytoplasmic vesicles and impairing its translocation to the nucleus. Consequently, impairs GSK3A-dependent transcriptional program and regulation of the DNA damage response occurring during T cells proliferation. Required for the survival of peripheral T cells, natural killer (NK) and NK T-cell development and the maintenance of normal liver function. May promote the survival of mature T lymphocytes upon cytokine withdrawal. May regulate Ca(2+) homeostasis by modulating lysosomal Ca(2+) stores, preventing its accumulation in the absence of T cell activation. May play a role in mitochondrial DNA segregation in hematopoietic tissues. Is a regulator of liver endothelial cell homeostasis.
Uniprot ID
Q96F15
Ensemble ID
ENST00000358647.5
HGNC ID
HGNC:18005

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
A172 SNV: p.L295F .
HEC1B SNV: p.P109Q .
NUGC3 Deletion: p.H112TfsTer6 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info  		Y9(20.00)  LDD0260  [1]
HPAP
 Probe Info  		3.25  LDD0064  [2]
DBIA
 Probe Info  		C238(209.70)  LDD0209  [3]
4-Iodoacetamidophenylacetylene
 Probe Info  		C238(0.00); C185(0.00)  LDD0038  [4]
IA-alkyne
 Probe Info  		C238(0.00); C185(0.00)  LDD0036  [4]
Lodoacetamide azide
 Probe Info  		C171(0.00); C238(0.00); C185(0.00)  LDD0037  [4]
Compound 10
 Probe Info  		N.A.  LDD2216  [5]
Compound 11
 Probe Info  		N.A.  LDD2213  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 HG-3 C278(2.12)  LDD2355  [6]
 LDCM0023  KB03 Jurkat C238(209.70)  LDD0209  [3]
 LDCM0024  KB05 MONO-MAC-6 C278(1.66)  LDD3335  [6]
 LDCM0014  Panhematin hPBMC 3.25  LDD0064  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
Very long chain fatty acid elongase 4 (ELOVL4) ELO family Q9GZR5
Glutathione S-transferase 3, mitochondrial (MGST3) MAPEG family O14880
Microsomal glutathione S-transferase 2 (MGST2) MAPEG family Q99735
Prostaglandin E synthase (PTGES) MAPEG family O14684
E3 ubiquitin-protein ligase RNF19B (RNF19B) RBR family Q6ZMZ0
Ribonuclease kappa (RNASEK) RNase K family Q6P5S7
ADP-ribosylation factor-like protein 13B (ARL13B) Arf family Q3SXY8
Plasma membrane ascorbate-dependent reductase CYBRD1 (CYBRD1) . Q53TN4
Thioredoxin-related transmembrane protein 1 (TMX1) . Q9H3N1
Transmembrane ascorbate-dependent reductase CYB561 (CYB561) . P49447
Transporter and channel
Click To Hide/Show 18 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Stomatin (STOM) Band 7/mec-2 family P27105
Hepatic sodium/bile acid cotransporter (SLC10A1) Bile acid:sodium symporter (BASS) family Q14973
Claudin-7 (CLDN7) Claudin family O95471
Gap junction alpha-8 protein (GJA8) Connexin family P48165
Gap junction beta-3 protein (GJB3) Connexin family O75712
Transmembrane 4 L6 family member 18 (TM4SF18) L6 tetraspanin family Q96CE8
Transmembrane 4 L6 family member 19 (TM4SF19) L6 tetraspanin family Q96DZ7
Aquaporin-3 (AQP3) MIP/aquaporin (TC 1.A.8) family Q92482
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Membrane-spanning 4-domains subfamily A member 14 (MS4A14) MS4A family Q96JA4
Sodium channel regulatory subunit beta-3 (SCN3B) Sodium channel auxiliary subunit SCN3B family Q9NY72
Synaptotagmin-1 (SYT1) Synaptotagmin family P21579
Syntaxin-1A (STX1A) Syntaxin family Q16623
Syntaxin-4 (STX4) Syntaxin family Q12846
Leukocyte surface antigen CD53 (CD53) Tetraspanin (TM4SF) family P19397
Cation-dependent mannose-6-phosphate receptor (M6PR) . P20645
Protrudin (ZFYVE27) . Q5T4F4
Thioredoxin-related transmembrane protein 2 (TMX2) . Q9Y320
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) BZIP family Q96BA8
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Adhesion G protein-coupled receptor G3 (ADGRG3) G-protein coupled receptor 2 family Q86Y34
Immunoglobulin
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Killer cell immunoglobulin-like receptor 3DL3 (KIR3DL3) Immunoglobulin superfamily Q8N743
Myeloid cell surface antigen CD33 (CD33) SIGLEC (sialic acid binding Ig-like lectin) family P20138
Allergin-1 (MILR1) . Q7Z6M3
Cytokine and receptor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ectodysplasin-A (EDA) Tumor necrosis factor family Q92838
Interferon gamma receptor 2 (IFNGR2) Type II cytokine receptor family P38484
Tumor necrosis factor receptor superfamily member 27 (EDA2R) . Q9HAV5
Other
Click To Hide/Show 17 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Dickkopf-related protein 4 (DKK4) Dickkopf family Q9UBT3
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Membrane protein FAM174A (FAM174A) FAM174 family Q8TBP5
Protein FAM210B, mitochondrial (FAM210B) FAM210 family Q96KR6
RAB6-interacting golgin (GORAB) GORAB family Q5T7V8
Protein jagunal homolog 1 (JAGN1) Jagunal family Q8N5M9
Low-density lipoprotein receptor class A domain-containing protein 1 (LDLRAD1) LDLR family Q5T700
Epithelial membrane protein 1 (EMP1) PMP-22/EMP/MP20 family P54849
Reticulophagy regulator 3 (RETREG3) RETREG family Q86VR2
Protein shisa-like-1 (SHISAL1) Shisa family Q3SXP7
Fetal and adult testis-expressed transcript protein (FATE1) . Q969F0
GRAM domain-containing protein 2B (GRAMD2B) . Q96HH9
Leucine-rich single-pass membrane protein 2 (LSMEM2) . Q8N112
PDZK1-interacting protein 1 (PDZK1IP1) . Q13113
Protein KASH5 (KASH5) . Q8N6L0
Small integral membrane protein 3 (SMIM3) . Q9BZL3
Sperm acrosome membrane-associated protein 1 (SPACA1) . Q9HBV2

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 A Chemical Proteomic Map of Heme-Protein Interactions. J Am Chem Soc. 2022 Aug 24;144(33):15013-15019. doi: 10.1021/jacs.2c06104. Epub 2022 Aug 12.
Mass spectrometry data entry: PXD034651
3 Covalent Inhibition by a Natural Product-Inspired Latent Electrophile. J Am Chem Soc. 2023 May 24;145(20):11097-11109. doi: 10.1021/jacs.3c00598. Epub 2023 May 15.
4 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
5 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279
6 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840