Details of the Target
General Information of Target
| Target ID | LDTP09975 | |||||
|---|---|---|---|---|---|---|
| Target Name | Histone H2B type 1-H (H2BC9) | |||||
| Gene Name | H2BC9 | |||||
| Gene ID | 8345 | |||||
| Synonyms |
H2BFJ; HIST1H2BH; Histone H2B type 1-H; H2B-clustered histone 9; Histone H2B.j; H2B/j |
|||||
| 3D Structure | ||||||
| Sequence |
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKAKGK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Histone H2B family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
ILS-1 Probe Info |
![]() |
2.19 | LDD0415 | [1] | |
|
HHS-475 Probe Info |
![]() |
Y84(1.13) | LDD0264 | [2] | |
|
HHS-465 Probe Info |
![]() |
Y84(2.95) | LDD2237 | [3] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0221 | [4] | |
|
SF Probe Info |
![]() |
Y84(0.00); Y41(0.00); K35(0.00); K86(0.00) | LDD0028 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0108 | Chloroacetamide | HeLa | N.A. | LDD0222 | [4] |
| LDCM0116 | HHS-0101 | DM93 | Y84(1.13) | LDD0264 | [2] |
| LDCM0117 | HHS-0201 | DM93 | Y84(1.00) | LDD0265 | [2] |
| LDCM0118 | HHS-0301 | DM93 | Y84(1.27) | LDD0266 | [2] |
| LDCM0119 | HHS-0401 | DM93 | Y84(1.26) | LDD0267 | [2] |
| LDCM0120 | HHS-0701 | DM93 | Y84(1.74) | LDD0268 | [2] |
| LDCM0107 | IAA | HeLa | N.A. | LDD0221 | [4] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0223 | [4] |
The Interaction Atlas With This Target
References





