General Information of Target

Target ID LDTP09953
Target Name Interferon regulatory factor 7 (IRF7)
Gene Name IRF7
Gene ID 3665
Synonyms
Interferon regulatory factor 7; IRF-7
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESMLDIALLMAN
ASQLKAVVEQGPSFAFYVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNN
LATGLVFIIVVVNIFITAFGVQKPLMDMAPQQ
Target Bioclass
Transcription factor
Family
IRF family
Subcellular location
Nucleus
Function
Key transcriptional regulator of type I interferon (IFN)-dependent immune responses and plays a critical role in the innate immune response against DNA and RNA viruses. Regulates the transcription of type I IFN genes (IFN-alpha and IFN-beta) and IFN-stimulated genes (ISG) by binding to an interferon-stimulated response element (ISRE) in their promoters. Can efficiently activate both the IFN-beta (IFNB) and the IFN-alpha (IFNA) genes and mediate their induction via both the virus-activated, MyD88-independent pathway and the TLR-activated, MyD88-dependent pathway. Induces transcription of ubiquitin hydrolase USP25 mRNA in response to lipopolysaccharide (LPS) or viral infection in a type I IFN-dependent manner. Required during both the early and late phases of the IFN gene induction but is more critical for the late than for the early phase. Exists in an inactive form in the cytoplasm of uninfected cells and following viral infection, double-stranded RNA (dsRNA), or toll-like receptor (TLR) signaling, becomes phosphorylated by IKBKE and TBK1 kinases. This induces a conformational change, leading to its dimerization and nuclear localization where along with other coactivators it can activate transcription of the type I IFN and ISG genes. Can also play a role in regulating adaptive immune responses by inducing PSMB9/LMP2 expression, either directly or through induction of IRF1. Binds to the Q promoter (Qp) of EBV nuclear antigen 1 a (EBNA1) and may play a role in the regulation of EBV latency. Can activate distinct gene expression programs in macrophages and regulate the anti-tumor properties of primary macrophages.
Uniprot ID
Q92985
Ensemble ID
ENST00000330243.9
HGNC ID
HGNC:6122

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
Curcusone 37
 Probe Info 
10.54  LDD0188  [1]
DBIA
 Probe Info 
C394(10.13)  LDD0209  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0033  Curcusone1d MCF-7 10.54  LDD0188  [1]
 LDCM0022  KB02 HEK-293T C97(0.88)  LDD1492  [3]
 LDCM0023  KB03 Jurkat C394(10.13)  LDD0209  [2]
 LDCM0024  KB05 HEK-293T C97(0.84)  LDD1502  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
tRNA (adenine(58)-N(1))-methyltransferase, mitochondrial (TRMT61B) TRM61 family Q9BVS5
E3 ubiquitin-protein ligase listerin (LTN1) LTN1 family O94822
Paladin (PALD1) Paladin family Q9ULE6
Serine/threonine-protein kinase tousled-like 2 (TLK2) Ser/Thr protein kinase family Q86UE8
Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK) Ser/Thr protein kinase family O15111
Serine/threonine-protein kinase TBK1 (TBK1) Ser/Thr protein kinase family Q9UHD2
Interleukin-1 receptor-associated kinase 1 (IRAK1) TKL Ser/Thr protein kinase family P51617
Serine/threonine-protein kinase A-Raf (ARAF) TKL Ser/Thr protein kinase family P10398
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
PAT complex subunit CCDC47 (CCDC47) CCDC47 family Q96A33
Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
AH receptor-interacting protein (AIP) . O00170

References

1 Total Synthesis and Target Identification of the Curcusone Diterpenes. J Am Chem Soc. 2021 Mar 24;143(11):4379-4386. doi: 10.1021/jacs.1c00557. Epub 2021 Mar 11.
2 Covalent Inhibition by a Natural Product-Inspired Latent Electrophile. J Am Chem Soc. 2023 May 24;145(20):11097-11109. doi: 10.1021/jacs.3c00598. Epub 2023 May 15.
3 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402