Details of the Target
General Information of Target
Target ID | LDTP09588 | |||||
---|---|---|---|---|---|---|
Target Name | Sodium-coupled neutral amino acid transporter 5 (SLC38A5) | |||||
Gene Name | SLC38A5 | |||||
Gene ID | 92745 | |||||
Synonyms |
JM24; SN2; SNAT5; Sodium-coupled neutral amino acid transporter 5; Solute carrier family 38 member 5; System N transporter 2 |
|||||
3D Structure | ||||||
Sequence |
MELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQFMDFEGKTSFGMSVFNLSNA
IMGSGILGLAYAMAHTGVIFFLALLLCIALLSSYSIHLLLTCAGIAGIRAYEQLGQRAFG PAGKVVVATVICLHNVGAMSSYLFIIKSELPLVIGTFLYMDPEGDWFLKGNLLIIIVSVL IILPLALMKHLGYLGYTSGLSLTCMLFFLVSVIYKKFQLGCAIGHNETAMESEALVGLPS QGLNSSCEAQMFTVDSQMSYTVPIMAFAFVCHPEVLPIYTELCRPSKRRMQAVANVSIGA MFCMYGLTATFGYLTFYSSVKAEMLHMYSQKDPLILCVRLAVLLAVTLTVPVVLFPIRRA LQQLLFPGKAFSWPRHVAIALILLVLVNVLVICVPTIRDIFGVIGSTSAPSLIFILPSIF YLRIVPSEVEPFLSWPKIQALCFGVLGVLFMAVSLGFMFANWATGQSRMSGH |
|||||
Target Type |
Literature-reported
|
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
Amino acid/polyamine transporter 2 family
|
|||||
Subcellular location |
Cell membrane
|
|||||
Function |
Symporter that cotransports neutral amino acids and sodium ions, coupled to an H(+) antiporter activity. Releases L-glutamine and glycine from astroglial cells and may participate in the glutamate/GABA-L-glutamine cycle and the NMDA receptors activation. In addition, contributes significantly to L-glutamine uptake in retina, namely in ganglion and Mueller cells therefore, participates in the retinal glutamate-glutamine cycle. The transport activity is pH sensitive and Li(+) tolerant. Moreover functions in both direction and is associated with large uncoupled fluxes of protons. The transport is electroneutral coupled to the cotransport of 1 Na(+) and the antiport of 1 H(+). May have a particular importance for modulation of net hepatic glutamine flux.
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IA-alkyne Probe Info |
![]() |
C337(2.23) | LDD2186 | [1] | |
IPM Probe Info |
![]() |
C283(3.04) | LDD1701 | [2] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
VE-P Probe Info |
![]() |
N.A. | LDD0396 | [3] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0625 | F8 | Ramos | C337(0.98) | LDD2187 | [1] |
LDCM0573 | Fragment11 | Ramos | C337(1.96) | LDD2190 | [1] |
LDCM0575 | Fragment13 | Ramos | C337(1.01) | LDD2192 | [1] |
LDCM0580 | Fragment21 | Ramos | C337(1.41) | LDD2195 | [1] |
LDCM0582 | Fragment23 | Ramos | C337(1.36) | LDD2196 | [1] |
LDCM0578 | Fragment27 | Ramos | C337(0.87) | LDD2197 | [1] |
LDCM0586 | Fragment28 | Ramos | C337(0.79) | LDD2198 | [1] |
LDCM0588 | Fragment30 | Ramos | C337(1.79) | LDD2199 | [1] |
LDCM0589 | Fragment31 | Ramos | C337(1.26) | LDD2200 | [1] |
LDCM0468 | Fragment33 | Ramos | C337(1.22) | LDD2202 | [1] |
LDCM0596 | Fragment38 | Ramos | C337(1.20) | LDD2203 | [1] |
LDCM0610 | Fragment52 | Ramos | C337(1.15) | LDD2204 | [1] |
LDCM0614 | Fragment56 | Ramos | C337(0.89) | LDD2205 | [1] |
LDCM0569 | Fragment7 | Ramos | C337(2.23) | LDD2186 | [1] |
LDCM0023 | KB03 | MDA-MB-231 | C283(3.04) | LDD1701 | [2] |
The Interaction Atlas With This Target
References