Details of the Target

General Information of Target

Target ID LDTP09575
Target Name Histone deacetylase 7 (HDAC7)
Gene Name HDAC7
Gene ID 51564
Synonyms
HDAC7A; Histone deacetylase 7; HD7; EC 3.5.1.98; Histone deacetylase 7A; HD7a
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVG
PQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPL
ETEGATRSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKE
SAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQETSV
APFALPTVSLLPAITLGLPAPARADSDRRTHPTLGPRGPILGSPHTPLFLPHGLEPEAGG
TLPSRLQPILLLDPSGSHAPLLTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRSEP
LPPSATAPPPPGPMQPRLEQLKTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGPGQVV
DDGLEHRELGHGQPEARGPAPLQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGGHRP
LSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDNSR
HPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLD
NGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNG
FAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQ
DPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRI
VVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALE
GGHDLTAICDASEACVAALLGNRVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQR
LASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL
Target Type
Patented-recorded
Target Bioclass
Enzyme
Family
Histone deacetylase family, HD type 2 subfamily
Subcellular location
Nucleus
Function
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation by repressing transcription of myocyte enhancer factors such as MEF2A, MEF2B and MEF2C. During muscle differentiation, it shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors. May be involved in Epstein-Barr virus (EBV) latency, possibly by repressing the viral BZLF1 gene. Positively regulates the transcriptional repressor activity of FOXP3. Serves as a corepressor of RARA, causing its deacetylation and inhibition of RARE DNA element binding. In association with RARA, plays a role in the repression of microRNA-10a and thereby in the inflammatory response.
TTD ID
T98698
Uniprot ID
Q8WUI4
DrugMap ID
TTMUEK1
Ensemble ID
ENST00000080059.12
HGNC ID
HGNC:14067
ChEMBL ID
CHEMBL2716

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
DBIA
 Probe Info  		C943(1.45)  LDD3316  [2]
4-Iodoacetamidophenylacetylene
 Probe Info  		C904(0.00); C618(0.00)  LDD0038  [3]
IA-alkyne
 Probe Info  		C904(0.00); C618(0.00); C897(0.00)  LDD0036  [3]
Lodoacetamide azide
 Probe Info  		C904(0.00); C618(0.00); C897(0.00)  LDD0037  [3]
Crotonaldehyde
 Probe Info  		N.A.  LDD0219  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0214  AC1 HEK-293T C904(0.89); C533(1.07)  LDD1507  [5]
 LDCM0215  AC10 HEK-293T C904(0.98); C533(0.97)  LDD1508  [5]
 LDCM0276  AC17 HEK-293T C904(0.98); C533(1.21)  LDD1515  [5]
 LDCM0277  AC18 HEK-293T C904(0.93); C533(0.85)  LDD1516  [5]
 LDCM0279  AC2 HEK-293T C904(0.99); C533(0.80)  LDD1518  [5]
 LDCM0281  AC21 HEK-293T C904(0.97)  LDD1520  [5]
 LDCM0285  AC25 HEK-293T C904(0.94); C533(0.96)  LDD1524  [5]
 LDCM0286  AC26 HEK-293T C904(0.98); C533(1.02)  LDD1525  [5]
 LDCM0289  AC29 HEK-293T C904(0.95)  LDD1528  [5]
 LDCM0294  AC33 HEK-293T C904(1.06); C533(1.15)  LDD1533  [5]
 LDCM0295  AC34 HEK-293T C904(0.97); C533(0.86)  LDD1534  [5]
 LDCM0298  AC37 HEK-293T C904(1.02)  LDD1537  [5]
 LDCM0303  AC41 HEK-293T C904(0.99); C533(1.16)  LDD1542  [5]
 LDCM0304  AC42 HEK-293T C904(0.90); C533(0.83)  LDD1543  [5]
 LDCM0307  AC45 HEK-293T C904(0.95)  LDD1546  [5]
 LDCM0311  AC49 HEK-293T C904(0.99); C533(0.99)  LDD1550  [5]
 LDCM0312  AC5 HEK-293T C904(1.00)  LDD1551  [5]
 LDCM0313  AC50 HEK-293T C904(1.09); C533(0.74)  LDD1552  [5]
 LDCM0316  AC53 HEK-293T C904(1.01)  LDD1555  [5]
 LDCM0320  AC57 HEK-293T C904(1.05); C533(1.26)  LDD1559  [5]
 LDCM0321  AC58 HEK-293T C904(0.98); C533(0.84)  LDD1560  [5]
 LDCM0325  AC61 HEK-293T C904(1.16)  LDD1564  [5]
 LDCM0248  AKOS034007472 HEK-293T C904(1.06)  LDD1511  [5]
 LDCM0356  AKOS034007680 HEK-293T C904(1.00); C533(0.94)  LDD1570  [5]
 LDCM0156  Aniline NCI-H1299 12.25  LDD0403  [1]
 LDCM0369  CL100 HEK-293T C533(0.71)  LDD1573  [5]
 LDCM0373  CL104 HEK-293T C533(0.84)  LDD1577  [5]
 LDCM0377  CL108 HEK-293T C533(0.86)  LDD1581  [5]
 LDCM0382  CL112 HEK-293T C533(0.97)  LDD1586  [5]
 LDCM0386  CL116 HEK-293T C533(0.93)  LDD1590  [5]
 LDCM0391  CL120 HEK-293T C533(0.83)  LDD1595  [5]
 LDCM0395  CL124 HEK-293T C533(0.94)  LDD1599  [5]
 LDCM0399  CL128 HEK-293T C533(0.97)  LDD1603  [5]
 LDCM0403  CL16 HEK-293T C533(0.76)  LDD1607  [5]
 LDCM0404  CL17 HEK-293T C904(1.73); C533(1.19)  LDD1608  [5]
 LDCM0405  CL18 HEK-293T C904(1.23); C533(1.00)  LDD1609  [5]
 LDCM0409  CL21 HEK-293T C904(1.11)  LDD1613  [5]
 LDCM0416  CL28 HEK-293T C533(0.88)  LDD1620  [5]
 LDCM0417  CL29 HEK-293T C904(0.84); C533(1.06)  LDD1621  [5]
 LDCM0419  CL30 HEK-293T C904(0.94); C533(0.76)  LDD1623  [5]
 LDCM0422  CL33 HEK-293T C904(1.16)  LDD1626  [5]
 LDCM0429  CL4 HEK-293T C533(0.78)  LDD1633  [5]
 LDCM0430  CL40 HEK-293T C533(0.81)  LDD1634  [5]
 LDCM0431  CL41 HEK-293T C904(1.18); C533(1.23)  LDD1635  [5]
 LDCM0432  CL42 HEK-293T C904(0.97); C533(0.76)  LDD1636  [5]
 LDCM0435  CL45 HEK-293T C904(1.29)  LDD1639  [5]
 LDCM0440  CL5 HEK-293T C904(1.13); C533(1.21)  LDD1644  [5]
 LDCM0443  CL52 HEK-293T C533(0.78)  LDD1646  [5]
 LDCM0444  CL53 HEK-293T C904(1.03); C533(1.27)  LDD1647  [5]
 LDCM0445  CL54 HEK-293T C904(1.02); C533(0.71)  LDD1648  [5]
 LDCM0448  CL57 HEK-293T C904(1.13)  LDD1651  [5]
 LDCM0451  CL6 HEK-293T C904(0.98); C533(0.86)  LDD1654  [5]
 LDCM0456  CL64 HEK-293T C533(1.05)  LDD1659  [5]
 LDCM0457  CL65 HEK-293T C904(1.10); C533(1.05)  LDD1660  [5]
 LDCM0458  CL66 HEK-293T C904(1.19); C533(1.01)  LDD1661  [5]
 LDCM0461  CL69 HEK-293T C904(1.08)  LDD1664  [5]
 LDCM0469  CL76 HEK-293T C533(0.90)  LDD1672  [5]
 LDCM0470  CL77 HEK-293T C904(1.42); C533(0.95)  LDD1673  [5]
 LDCM0471  CL78 HEK-293T C904(1.09); C533(1.11)  LDD1674  [5]
 LDCM0475  CL81 HEK-293T C904(1.19)  LDD1678  [5]
 LDCM0482  CL88 HEK-293T C533(0.75)  LDD1685  [5]
 LDCM0483  CL89 HEK-293T C904(1.10); C533(0.79)  LDD1686  [5]
 LDCM0484  CL9 HEK-293T C904(1.24)  LDD1687  [5]
 LDCM0485  CL90 HEK-293T C904(1.13); C533(0.71)  LDD1688  [5]
 LDCM0488  CL93 HEK-293T C904(1.05)  LDD1691  [5]
 LDCM0625  F8 Ramos C904(1.70)  LDD2187  [6]
 LDCM0572  Fragment10 Ramos C904(3.24)  LDD2189  [6]
 LDCM0574  Fragment12 Ramos C904(2.07)  LDD2191  [6]
 LDCM0575  Fragment13 Ramos C904(1.04)  LDD2192  [6]
 LDCM0576  Fragment14 Ramos C904(0.85)  LDD2193  [6]
 LDCM0579  Fragment20 Ramos C904(1.77)  LDD2194  [6]
 LDCM0580  Fragment21 Ramos C904(0.89)  LDD2195  [6]
 LDCM0582  Fragment23 Ramos C904(0.85)  LDD2196  [6]
 LDCM0578  Fragment27 Ramos C904(1.21)  LDD2197  [6]
 LDCM0586  Fragment28 Ramos C904(0.35)  LDD2198  [6]
 LDCM0588  Fragment30 Ramos C904(1.31)  LDD2199  [6]
 LDCM0589  Fragment31 Ramos C904(1.03)  LDD2200  [6]
 LDCM0590  Fragment32 Ramos C904(1.36)  LDD2201  [6]
 LDCM0468  Fragment33 Ramos C904(1.35)  LDD2202  [6]
 LDCM0596  Fragment38 Ramos C904(1.01)  LDD2203  [6]
 LDCM0566  Fragment4 Ramos C904(1.28)  LDD2184  [6]
 LDCM0610  Fragment52 Ramos C904(1.35)  LDD2204  [6]
 LDCM0614  Fragment56 Ramos C904(1.14)  LDD2205  [6]
 LDCM0569  Fragment7 Ramos C904(1.48)  LDD2186  [6]
 LDCM0022  KB02 Ramos C904(3.02)  LDD2182  [6]
 LDCM0023  KB03 Ramos C904(1.42)  LDD2183  [6]
 LDCM0024  KB05 MEL167 C943(1.45)  LDD3316  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Adenine nucleotide translocase lysine N-methyltransferase (ANTKMT) ANT/ATPSC lysine N-methyltransferase family Q9BQD7
Nucleoside diphosphate kinase, mitochondrial (NME4) NDK family O00746
Serine/threonine-protein kinase D2 (PRKD2) CAMK Ser/Thr protein kinase family Q9BZL6
Epidermal growth factor receptor (EGFR) Tyr protein kinase family P00533
Ras-related protein R-Ras2 (RRAS2) Ras family P62070
Ras-related C3 botulinum toxin substrate 1 (RAC1) Rho family P63000
Ras-related C3 botulinum toxin substrate 2 (RAC2) Rho family P15153
Ras-related C3 botulinum toxin substrate 3 (RAC3) Rho family P60763
Cell division control protein 42 homolog (CDC42) Rho family P60953
Nuclear receptor-interacting protein 2 (NRIP2) . Q9BQI9
Ubiquitin-like protein 3 (UBL3) . O95164
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
14-3-3 protein zeta/delta (YWHAZ) 14-3-3 family P63104
Monocarboxylate transporter 4 (SLC16A3) Monocarboxylate porter (TC 2.A.1.13) family O15427
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Krueppel-like factor 16 (KLF16) Sp1 C2H2-type zinc-finger protein family Q9BXK1
AT-rich interactive domain-containing protein 5A (ARID5A) . Q03989
Proto-oncogene c-Rel (REL) . Q04864
Other
Click To Hide/Show 14 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
14-3-3 protein sigma (SFN) 14-3-3 family P31947
Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) CALCOCO family Q13137
Centromere protein Q (CENPQ) CENP-Q/OKP1 family Q7L2Z9
DNA damage-inducible transcript 4-like protein (DDIT4L) DDIT4 family Q96D03
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 (GNG12) G protein gamma family Q9UBI6
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
LIM domain-binding protein 2 (LDB2) LDB family O43679
Protein ripply1 (RIPPLY1) Ripply family Q0D2K3
Migration and invasion enhancer 1 (MIEN1) SelWTH family Q9BRT3
Endothelial cell-specific molecule 1 (ESM1) . Q9NQ30
KRAB-A domain-containing protein 2 (KRBA2) . Q6ZNG9
Protein phosphatase 1 regulatory subunit 16A (PPP1R16A) . Q96I34
Putative TGFB1-induced anti-apoptotic factor 1 (MYO18A) . O95411
Uncharacterized protein C3orf36 (C3orf36) . Q3SXR2

The Drug(s) Related To This Target

Approved
Click To Hide/Show 6 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Decitabine Small molecular drug DB01262
Phenylbutyric Acid Small molecular drug DB06819
Propanoic Acid Small molecular drug DB03766
Romidepsin Small molecular drug DB06176
Valproic Acid Small molecular drug DB00313
Vorinostat Small molecular drug DB02546
Investigative
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Abexinostat Small molecular drug DB12565
Tmp269 Small molecular drug D0R7JA
Trichostatin A Small molecular drug DB04297
Patented
Click To Hide/Show 8 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Pmid29671355-compound-21 Small molecular drug D0LP1K
Pmid29671355-compound-25 Small molecular drug D0RA0D
Pmid29671355-compound-31 Small molecular drug D0DI9S
Pmid29671355-compound-43 Small molecular drug D0BP8I
Pmid29671355-compound-45a Small molecular drug D0YN2T
Pmid29671355-compound-56 Small molecular drug D0CH8Q
Pmid29671355-compound-62 Small molecular drug D07WAT
Pmid29671355-compound-67 Small molecular drug D0M0RE

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
4 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
5 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
6 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578