Details of the Target
General Information of Target
Target ID | LDTP09566 | |||||
---|---|---|---|---|---|---|
Target Name | TBC1 domain family member 22A (TBC1D22A) | |||||
Gene Name | TBC1D22A | |||||
Gene ID | 25771 | |||||
Synonyms |
C22orf4; TBC1 domain family member 22A |
|||||
3D Structure | ||||||
Sequence |
MASDGARKQFWKRSNSKLPGSIQHVYGAQHPPFDPLLHGTLLRSTAKMPTTPVKAKRVST
FQEFESNTSDAWDAGEDDDELLAMAAESLNSEVVMETANRVLRNHSQRQGRPTLQEGPGL QQKPRPEAEPPSPPSGDLRLVKSVSESHTSCPAESASDAAPLQRSQSLPHSATVTLGGTS DPSTLSSSALSEREASRLDKFKQLLAGPNTDLEELRRLSWSGIPKPVRPMTWKLLSGYLP ANVDRRPATLQRKQKEYFAFIEHYYDSRNDEVHQDTYRQIHIDIPRMSPEALILQPKVTE IFERILFIWAIRHPASGYVQGINDLVTPFFVVFICEYIEAEEVDTVDVSGVPAEVLCNIE ADTYWCMSKLLDGIQDNYTFAQPGIQMKVKMLEELVSRIDEQVHRHLDQHEVRYLQFAFR WMNNLLMREVPLRCTIRLWDTYQSEPDGFSHFHLYVCAAFLVRWRKEILEEKDFQELLLF LQNLPTAHWDDEDISLLLAEAYRLKFAFADAPNHYKK |
|||||
Target Bioclass |
Other
|
|||||
Function | May act as a GTPase-activating protein for Rab family protein(s). | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Cell line | Mutation details | Probe for labeling this protein in this cell | |||
---|---|---|---|---|---|
GAMG | SNV: p.T149A | . | |||
HCT15 | SNV: p.A459D | . | |||
Ishikawa (Heraklio) 02 ER | Substitution: p.Y364_W365delinsTer | . | |||
KMCH1 | SNV: p.E360D | . | |||
MELJUSO | SNV: p.L204R | . | |||
NCIH1299 | SNV: p.A83S | m-APA Probe Info | |||
NCIH1703 | SNV: p.P52T | . |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K202(5.00) | LDD0277 | [1] | |
DBIA Probe Info |
![]() |
C151(1.84) | LDD3378 | [2] | |
AHL-Pu-1 Probe Info |
![]() |
C151(2.24) | LDD0169 | [3] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0222 | [4] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0165 | [5] | |
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [6] | |
Compound 11 Probe Info |
![]() |
N.A. | LDD2213 | [7] | |
IPM Probe Info |
![]() |
N.A. | LDD0005 | [8] | |
VSF Probe Info |
![]() |
N.A. | LDD0007 | [8] | |
Methacrolein Probe Info |
![]() |
C151(0.00); H148(0.00) | LDD0218 | [4] | |
m-APA Probe Info |
![]() |
N.A. | LDD0404 | [9] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0026 | 4SU-RNA+native RNA | HEK-293T | C151(2.24) | LDD0169 | [3] |
LDCM0156 | Aniline | NCI-H1299 | N.A. | LDD0404 | [9] |
LDCM0108 | Chloroacetamide | HeLa | N.A. | LDD0222 | [4] |
LDCM0625 | F8 | Ramos | C151(1.27) | LDD2187 | [10] |
LDCM0572 | Fragment10 | Ramos | C151(1.63) | LDD2189 | [10] |
LDCM0573 | Fragment11 | Ramos | C151(14.25) | LDD2190 | [10] |
LDCM0574 | Fragment12 | Ramos | C151(1.00) | LDD2191 | [10] |
LDCM0575 | Fragment13 | Ramos | C151(0.78) | LDD2192 | [10] |
LDCM0576 | Fragment14 | Ramos | C151(0.47) | LDD2193 | [10] |
LDCM0579 | Fragment20 | Ramos | C151(0.59) | LDD2194 | [10] |
LDCM0580 | Fragment21 | Ramos | C151(0.79) | LDD2195 | [10] |
LDCM0582 | Fragment23 | Ramos | C151(1.43) | LDD2196 | [10] |
LDCM0578 | Fragment27 | Ramos | C151(0.86) | LDD2197 | [10] |
LDCM0586 | Fragment28 | Ramos | C151(0.83) | LDD2198 | [10] |
LDCM0588 | Fragment30 | Ramos | C151(1.67) | LDD2199 | [10] |
LDCM0589 | Fragment31 | Ramos | C151(1.13) | LDD2200 | [10] |
LDCM0590 | Fragment32 | Ramos | C151(1.86) | LDD2201 | [10] |
LDCM0468 | Fragment33 | Ramos | C151(1.24) | LDD2202 | [10] |
LDCM0596 | Fragment38 | Ramos | C151(0.91) | LDD2203 | [10] |
LDCM0566 | Fragment4 | Ramos | C151(1.13) | LDD2184 | [10] |
LDCM0610 | Fragment52 | Ramos | C151(1.31) | LDD2204 | [10] |
LDCM0614 | Fragment56 | Ramos | C151(1.20) | LDD2205 | [10] |
LDCM0569 | Fragment7 | Ramos | C151(1.18) | LDD2186 | [10] |
LDCM0571 | Fragment9 | Ramos | C151(1.01) | LDD2188 | [10] |
LDCM0022 | KB02 | Ramos | C151(1.86) | LDD2182 | [10] |
LDCM0023 | KB03 | Ramos | C151(1.00) | LDD2183 | [10] |
LDCM0024 | KB05 | OS-RC-2 | C151(1.84) | LDD3378 | [2] |
LDCM0131 | RA190 | MM1.R | C151(1.09) | LDD0304 | [11] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Golgi resident protein GCP60 (ACBD3) | . | Q9H3P7 | |||
Wolframin (WFS1) | . | O76024 |
References