Details of the Target

General Information of Target

Target ID LDTP09119
Target Name Paraneoplastic antigen Ma1 (PNMA1)
Gene Name PNMA1
Gene ID 9240
Synonyms
MA1; Paraneoplastic antigen Ma1; 37 kDa neuronal protein; Neuron- and testis-specific protein 1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAMTLLEDWCRGMDVNSQRALLVWGIPVNCDEAEIEETLQAAMPQVSYRMLGRMFWREEN
AKAALLELTGAVDYAAIPREMPGKGGVWKVLFKPPTSDAEFLERLHLFLAREGWTVQDVA
RVLGFQNPTPTPGPEMPAEMLNYILDNVIQPLVESIWYKRLTLFSGRDIPGPGEETFDPW
LEHTNEVLEEWQVSDVEKRRRLMESLRGPAADVIRILKSNNPAITTAECLKALEQVFGSV
ESSRDAQIKFLNTYQNPGEKLSAYVIRLEPLLQKVVEKGAIDKDNVNQARLEQVIAGANH
SGAIRRQLWLTGAGEGPAPNLFQLLVQIREEEAKEEEEEAEATLLQLGLEGHF
Target Bioclass
Other
Family
PNMA family
Subcellular location
Nucleus, nucleolus
Uniprot ID
Q8ND90
Ensemble ID
ENST00000316836.5
HGNC ID
HGNC:9158

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C30(0.84)  LDD1511  [1]
IA-alkyne
 Probe Info  		N.A.  LDD0162  [2]
NAIA_5
 Probe Info  		N.A.  LDD2223  [3]
PAL-AfBPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C278
 Probe Info  		68.12  LDD1948  [4]
C282
 Probe Info  		19.97  LDD1952  [4]
C284
 Probe Info  		22.32  LDD1954  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0281  AC21 HEK-293T C30(1.08)  LDD1520  [1]
 LDCM0289  AC29 HEK-293T C30(1.29)  LDD1528  [1]
 LDCM0298  AC37 HEK-293T C30(1.03)  LDD1537  [1]
 LDCM0307  AC45 HEK-293T C30(1.05)  LDD1546  [1]
 LDCM0312  AC5 HEK-293T C30(1.17)  LDD1551  [1]
 LDCM0316  AC53 HEK-293T C30(1.18)  LDD1555  [1]
 LDCM0325  AC61 HEK-293T C30(0.83)  LDD1564  [1]
 LDCM0248  AKOS034007472 HEK-293T C30(0.84)  LDD1511  [1]
 LDCM0409  CL21 HEK-293T C30(1.07)  LDD1613  [1]
 LDCM0422  CL33 HEK-293T C30(1.02)  LDD1626  [1]
 LDCM0435  CL45 HEK-293T C30(0.78)  LDD1639  [1]
 LDCM0448  CL57 HEK-293T C30(0.89)  LDD1651  [1]
 LDCM0461  CL69 HEK-293T C30(1.12)  LDD1664  [1]
 LDCM0475  CL81 HEK-293T C30(1.02)  LDD1678  [1]
 LDCM0484  CL9 HEK-293T C30(1.15)  LDD1687  [1]
 LDCM0488  CL93 HEK-293T C30(0.89)  LDD1691  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 28 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Paraplegin (SPG7) AAA ATPase family; Peptidase M41 family Q9UQ90
Histone-lysine N-methyltransferase SUV39H2 (SUV39H2) Histone-lysine methyltransferase family Q9H5I1
Peroxisomal bifunctional enzyme (EHHADH) Enoyl-CoA hydratase/isomerase family; 3-hydroxyacyl-CoA dehydrogenase family Q08426
Histone deacetylase 4 (HDAC4) Histone deacetylase family P56524
Ribonuclease P protein subunit p25 (RPP25) Histone-like Alba family Q9BUL9
Ribonuclease P protein subunit p25-like protein (RPP25L) Histone-like Alba family Q8N5L8
Protein mab-21-like 2 (MAB21L2) Mab-21 family Q9Y586
Probable bifunctional dTTP/UTP pyrophosphatase/methyltransferase protein (ASMTL) Maf family O95671
DNA replication licensing factor MCM7 (MCM7) MCM family P33993
Methyltransferase-like protein 17, mitochondrial (METTL17) Rsm22 family Q9H7H0
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
Tudor-interacting repair regulator protein (NUDT16L1) Nudix hydrolase family Q9BRJ7
Ubiquitin carboxyl-terminal hydrolase 2 (USP2) Peptidase C19 family O75604
AMSH-like protease (STAMBPL1) Peptidase M67C family Q96FJ0
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 (PIN4) PpiC/parvulin rotamase family Q9Y237
Protein kinase C iota type (PRKCI) AGC Ser/Thr protein kinase family P41743
Serine/threonine-protein kinase N1 (PKN1) AGC Ser/Thr protein kinase family Q16512
Serine/threonine-protein kinase N3 (PKN3) AGC Ser/Thr protein kinase family Q6P5Z2
MAP/microtubule affinity-regulating kinase 4 (MARK4) CAMK Ser/Thr protein kinase family Q96L34
Cyclin-dependent kinase 18 (CDK18) CMGC Ser/Thr protein kinase family Q07002
GTP-binding protein GEM (GEM) RGK family P55040
GTP-binding protein 10 (GTPBP10) OBG GTPase family A4D1E9
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
Aprataxin (APTX) . Q7Z2E3
Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 (CTDSP1) . Q9GZU7
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (PIN1) . Q13526
Transporter and channel
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Metal transporter CNNM3 (CNNM3) ACDP family Q8NE01
ATP synthase subunit O, mitochondrial (ATP5PO) ATPase delta chain family P48047
Cytochrome c oxidase subunit 5B, mitochondrial (COX5B) Cytochrome c oxidase subunit 5B family P10606
Solute carrier family 25 member 48 (SLC25A48) Mitochondrial carrier (TC 2.A.29) family Q6ZT89
V-type proton ATPase subunit G 1 (ATP6V1G1) V-ATPase G subunit family O75348
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Syntenin-1 (SDCBP) . O00560
Transcription factor
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-B9 (HOXB9) Abd-B homeobox family P17482
Zinc finger protein 35 (ZNF35) Krueppel C2H2-type zinc-finger protein family P13682
Zinc finger protein 438 (ZNF438) Krueppel C2H2-type zinc-finger protein family Q7Z4V0
Zinc finger protein 564 (ZNF564) Krueppel C2H2-type zinc-finger protein family Q8TBZ8
Teashirt homolog 2 (TSHZ2) Teashirt C2H2-type zinc-finger protein family Q9NRE2
AT-rich interactive domain-containing protein 5A (ARID5A) . Q03989
Forkhead box protein D4-like 1 (FOXD4L1) . Q9NU39
Forkhead box protein D4-like 3 (FOXD4L3) . Q6VB84
Transcriptional enhancer factor TEF-3 (TEAD4) . Q15561
Zinc finger protein 581 (ZNF581) . Q9P0T4
GPCR
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Neuropeptides B/W receptor type 2 (NPBWR2) G-protein coupled receptor 1 family P48146
Probable G-protein coupled receptor 25 (GPR25) G-protein coupled receptor 1 family O00155
Immunoglobulin
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Hyaluronan and proteoglycan link protein 2 (HAPLN2) HAPLN family Q9GZV7
Semaphorin-4C (SEMA4C) Semaphorin family Q9C0C4
Other
Click To Hide/Show 66 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein BEX2 (BEX2) BEX family Q9BXY8
Bystin (BYSL) Bystin family Q13895
Cilia- and flagella-associated protein 53 (CFAP53) CFAP53 family Q96M91
Cysteine-rich hydrophobic domain-containing protein 2 (CHIC2) CHIC family Q9UKJ5
EKC/KEOPS complex subunit LAGE3 (LAGE3) CTAG/PCC1 family Q14657
Cyclin-G1 (CCNG1) Cyclin family P51959
Death domain-associated protein 6 (DAXX) DAXX family Q9UER7
Dynactin subunit 4 (DCTN4) Dynactin subunit 4 family Q9UJW0
Protein FAM110A (FAM110A) FAM110 family Q9BQ89
Protein FAM161A (FAM161A) FAM161 family Q3B820
Protein FAM161B (FAM161B) FAM161 family Q96MY7
Protein fem-1 homolog C (FEM1C) Fem-1 family Q96JP0
Radial spoke head protein 9 homolog (RSPH9) Flagellar radial spoke RSP9 family Q9H1X1
Large ribosomal subunit protein mL64 (GADD45GIP1) Mitochondrion-specific ribosomal protein mL64 family Q8TAE8
Myozenin-1 (MYOZ1) Myozenin family Q9NP98
Testis-specific Y-encoded-like protein 4 (TSPYL4) Nucleosome assembly protein (NAP) family Q9UJ04
Partitioning defective 3 homolog (PARD3) PAR3 family Q8TEW0
Partitioning defective 6 homolog alpha (PARD6A) PAR6 family Q9NPB6
Partitioning defective 6 homolog beta (PARD6B) PAR6 family Q9BYG5
Paraneoplastic antigen-like protein 5 (PNMA5) PNMA family Q96PV4
Paraneoplastic antigen-like protein 6A (PNMA6A) PNMA family P0CW24
Prefoldin subunit 3 (VBP1) Prefoldin subunit alpha family P61758
Pre-mRNA-splicing factor 18 (PRPF18) PRP18 family Q99633
U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31) PRP31 family Q8WWY3
DNA repair protein RAD51 homolog 4 (RAD51D) RecA family O75771
U2 small nuclear ribonucleoprotein B'' (SNRPB2) RRM U1 A/B'' family P08579
Protein shisa-3 homolog (SHISA3) Shisa family A0PJX4
Speriolin-like protein (SPATC1L) Speriolin family Q9H0A9
Protein TASOR 2 (TASOR2) TASOR family Q5VWN6
T-cell leukemia/lymphoma protein 1B (TCL1B) TCL1 family O95988
Transcription elongation factor A protein 2 (TCEA2) TFS-II family Q15560
Troponin I, slow skeletal muscle (TNNI1) Troponin I family P19237
Tetratricopeptide repeat protein 9C (TTC9C) TTC9 family Q8N5M4
Macrophage immunometabolism regulator (MACIR) UNC119-binding protein family Q96GV9
Large ribosomal subunit protein uL10m (MRPL10) Universal ribosomal protein uL10 family Q7Z7H8
Large ribosomal subunit protein uL11m (MRPL11) Universal ribosomal protein uL11 family Q9Y3B7
Large ribosomal subunit protein uL23m (MRPL23) Universal ribosomal protein uL23 family Q16540
UPF0488 protein C8orf33 (C8orf33) UPF0488 family Q9H7E9
Zinc finger C2HC domain-containing protein 1C (ZC2HC1C) ZC2HC1 family Q53FD0
Zinc finger CCHC domain-containing protein 12 (ZCCHC12) ZCCHC12 family Q6PEW1
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
AP-4 complex accessory subunit RUSC1 (RUSC1) . Q9BVN2
Calcium-regulated heat-stable protein 1 (CARHSP1) . Q9Y2V2
Chromobox protein homolog 8 (CBX8) . Q9HC52
Enkurin domain-containing protein 1 (ENKD1) . Q9H0I2
Factor associated with metabolism and energy (CCDC198) . Q9NVL8
G patch domain and ankyrin repeat-containing protein 1 (GPANK1) . O95872
INO80 complex subunit B (INO80B) . Q9C086
KAT8 regulatory NSL complex subunit 1 (KANSL1) . Q7Z3B3
Protein lin-37 homolog (LIN37) . Q96GY3
Putative ankyrin repeat domain-containing protein 26-like 1 (ANKRD36BP1) . Q96IX9
Putative uncharacterized protein URB1-AS1 (URB1-AS1) . Q96HZ7
Putative Wilms tumor upstream neighbor 1 gene protein (WT1-AS) . Q06250
Receptor-transporting protein 5 (RTP5) . Q14D33
Rho guanine nucleotide exchange factor 6 (ARHGEF6) . Q15052
RNA-binding protein 41 (RBM41) . Q96IZ5
SCAN domain-containing protein 1 (SCAND1) . P57086
SH2 domain-containing protein 4A (SH2D4A) . Q9H788
SHC-transforming protein 3 (SHC3) . Q92529
Small integral membrane protein 3 (SMIM3) . Q9BZL3
SRA stem-loop-interacting RNA-binding protein, mitochondrial (SLIRP) . Q9GZT3
Thioredoxin domain-containing protein 9 (TXNDC9) . O14530
Transcription elongation factor A N-terminal and central domain-containing protein (TCEANC) . Q8N8B7
Ubiquilin-1 (UBQLN1) . Q9UMX0
VPS9 domain-containing protein 1 (VPS9D1) . Q9Y2B5
WD repeat-containing protein 25 (WDR25) . Q64LD2

References

1 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
2 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
3 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
4 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587