Details of the Target

General Information of Target

Target ID LDTP08980
Target Name Endonuclease V (ENDOV)
Gene Name ENDOV
Gene ID 284131
Synonyms
Endonuclease V; hEndoV; EC 3.1.26.-; Inosine-specific endoribonuclease
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MALEAAGGPPEETLSLWKREQARLKAHVVDRDTEAWQRDPAFSGLQRVGGVDVSFVKGDS
VRACASLVVLSFPELEVVYEESRMVSLTAPYVSGFLAFREVPFLLELVQQLREKEPGLMP
QVLLVDGNGVLHHRGFGVACHLGVLTDLPCVGVAKKLLQVDGLENNALHKEKIRLLQTRG
DSFPLLGDSGTVLGMALRSHDRSTRPLYISVGHRMSLEAAVRLTCCCCRFRIPEPVRQAD
ICSREHIRKSLGLPGPPTPRSPKAQRPVACPKGDSGESSALC
Target Bioclass
Enzyme
Family
Endonuclease V family
Subcellular location
Cytoplasm
Function
[Isoform 1]: Endoribonuclease that specifically cleaves inosine-containing RNAs: cleaves RNA at the second phosphodiester bond 3' to inosine. Active against both single-stranded and double-stranded RNAs. Has strong preference for single-stranded RNAs (ssRNAs) toward double-stranded RNAs (dsRNAs). Cleaves mRNAs and tRNAs containing inosine. Also able to cleave structure-specific dsRNA substrates containing the specific sites 5'-IIUI-3' and 5'-UIUU-3'. Inosine is present in a number of RNAs following editing; the function of inosine-specific endoribonuclease is still unclear: it could either play a regulatory role in edited RNAs, or be involved in antiviral response by removing the hyperedited long viral dsRNA genome that has undergone A-to-I editing (Probable). Binds branched DNA structures.; [Isoform 6]: Endoribonuclease that specifically cleaves inosine-containing RNAs: cleaves RNA at the second phosphodiester bond 3' to inosine. Active against both single-stranded and double-stranded RNAs. Cleaves tRNAs containing inosine.; [Isoform 7]: Endoribonuclease that specifically cleaves inosine-containing RNAs: cleaves RNA at the second phosphodiester bond 3' to inosine. Active against both single-stranded and double-stranded RNAs. Cleaves tRNAs containing inosine.
Uniprot ID
Q8N8Q3
Ensemble ID
ENST00000323854.9
HGNC ID
HGNC:26640

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
A101D SNV: p.P235L .
G361 Substitution: p.V28G .
HT1080 SNV: p.V78G .
OAW28 SNV: p.L87F .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C76(1.71)  LDD3311  [1]
IPM
 Probe Info  		N.A.  LDD0147  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0215  AC10 HEK-293T C225(1.09); C226(1.09)  LDD1508  [3]
 LDCM0259  AC14 HEK-293T C225(0.90); C226(0.90)  LDD1512  [3]
 LDCM0270  AC15 HEK-293T C150(1.05)  LDD1513  [3]
 LDCM0277  AC18 HEK-293T C225(1.00); C226(1.00)  LDD1516  [3]
 LDCM0279  AC2 HEK-293T C225(0.90); C226(0.90)  LDD1518  [3]
 LDCM0282  AC22 HEK-293T C225(1.02); C226(1.02)  LDD1521  [3]
 LDCM0283  AC23 HEK-293T C150(1.13)  LDD1522  [3]
 LDCM0286  AC26 HEK-293T C225(1.11); C226(1.11)  LDD1525  [3]
 LDCM0291  AC30 HEK-293T C225(0.90); C226(0.90)  LDD1530  [3]
 LDCM0292  AC31 HEK-293T C150(0.91)  LDD1531  [3]
 LDCM0295  AC34 HEK-293T C225(1.07); C226(1.07)  LDD1534  [3]
 LDCM0299  AC38 HEK-293T C225(0.88); C226(0.88)  LDD1538  [3]
 LDCM0300  AC39 HEK-293T C150(1.09)  LDD1539  [3]
 LDCM0304  AC42 HEK-293T C225(1.00); C226(1.00)  LDD1543  [3]
 LDCM0308  AC46 HEK-293T C225(0.89); C226(0.89)  LDD1547  [3]
 LDCM0309  AC47 HEK-293T C150(1.35)  LDD1548  [3]
 LDCM0313  AC50 HEK-293T C225(0.92); C226(0.92)  LDD1552  [3]
 LDCM0317  AC54 HEK-293T C225(0.93); C226(0.93)  LDD1556  [3]
 LDCM0318  AC55 HEK-293T C150(0.89)  LDD1557  [3]
 LDCM0321  AC58 HEK-293T C225(0.99); C226(0.99)  LDD1560  [3]
 LDCM0323  AC6 HEK-293T C225(0.87); C226(0.87)  LDD1562  [3]
 LDCM0326  AC62 HEK-293T C225(1.18); C226(1.18)  LDD1565  [3]
 LDCM0327  AC63 HEK-293T C150(0.94)  LDD1566  [3]
 LDCM0334  AC7 HEK-293T C150(0.90)  LDD1568  [3]
 LDCM0368  CL10 HEK-293T C225(1.23); C226(1.23)  LDD1572  [3]
 LDCM0379  CL11 HEK-293T C150(1.20)  LDD1583  [3]
 LDCM0405  CL18 HEK-293T C225(0.97); C226(0.97)  LDD1609  [3]
 LDCM0410  CL22 HEK-293T C225(0.97); C226(0.97)  LDD1614  [3]
 LDCM0411  CL23 HEK-293T C150(0.94)  LDD1615  [3]
 LDCM0419  CL30 HEK-293T C225(0.96); C226(0.96)  LDD1623  [3]
 LDCM0423  CL34 HEK-293T C225(0.97); C226(0.97)  LDD1627  [3]
 LDCM0424  CL35 HEK-293T C150(1.16)  LDD1628  [3]
 LDCM0432  CL42 HEK-293T C225(1.06); C226(1.06)  LDD1636  [3]
 LDCM0436  CL46 HEK-293T C225(1.17); C226(1.17)  LDD1640  [3]
 LDCM0437  CL47 HEK-293T C150(1.14)  LDD1641  [3]
 LDCM0445  CL54 HEK-293T C225(1.06); C226(1.06)  LDD1648  [3]
 LDCM0449  CL58 HEK-293T C225(1.08); C226(1.08)  LDD1652  [3]
 LDCM0450  CL59 HEK-293T C150(1.05)  LDD1653  [3]
 LDCM0451  CL6 HEK-293T C225(1.04); C226(1.04)  LDD1654  [3]
 LDCM0458  CL66 HEK-293T C225(1.05); C226(1.05)  LDD1661  [3]
 LDCM0463  CL70 HEK-293T C225(1.05); C226(1.05)  LDD1666  [3]
 LDCM0464  CL71 HEK-293T C150(1.15)  LDD1667  [3]
 LDCM0471  CL78 HEK-293T C225(1.02); C226(1.02)  LDD1674  [3]
 LDCM0476  CL82 HEK-293T C225(1.01); C226(1.01)  LDD1679  [3]
 LDCM0477  CL83 HEK-293T C150(1.46)  LDD1680  [3]
 LDCM0485  CL90 HEK-293T C225(0.84); C226(0.84)  LDD1688  [3]
 LDCM0489  CL94 HEK-293T C225(1.09); C226(1.09)  LDD1692  [3]
 LDCM0490  CL95 HEK-293T C150(1.09)  LDD1693  [3]
 LDCM0022  KB02 697 C76(1.89)  LDD2245  [1]
 LDCM0023  KB03 697 C76(2.14)  LDD2662  [1]
 LDCM0024  KB05 G361 C76(1.71)  LDD3311  [1]

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
3 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402