Details of the Target
General Information of Target
| Target ID | LDTP08890 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger CCCH-type with G patch domain-containing protein (ZGPAT) | |||||
| Gene Name | ZGPAT | |||||
| Gene ID | 84619 | |||||
| Synonyms |
GPATC6; GPATCH6; KIAA1847; ZC3H9; ZC3HDC9; ZIP; Zinc finger CCCH-type with G patch domain-containing protein; G patch domain-containing protein 6; Zinc finger CCCH domain-containing protein 9; Zinc finger and G patch domain-containing protein
|
|||||
| 3D Structure | ||||||
| Sequence |
MDEESLESALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELTEASLVSVRKS
SLLAALDEERPGRQEDAEYQAFREAITEAVEAPAAARGSGSETVPKAEAGPESAAGGQEE EEGEDEEELSGTKVSAPYYSSWGTLEYHNAMVVGTEEAEDGSAGVRVLYLYPTHKSLKPC PFFLEGKCRFKENCRFSHGQVVSLDELRPFQDPDLSSLQAGSACLAKHQDGLWHAARITD VDNGYYTVKFDSLLLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSA QSSALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRV EPIHAVVLPRGKSLDQCVETLQKQTRVGKAGTNKPPRCRGRGARPGGRPAPRNVFDFLNE KLQGQAPGALEAGAAPAGRRSKDMYHASKSAKRALSLRLFQTEEKIERTQRDIRSIQEAL ARNAGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcription repressor that specifically binds the 5'-GGAG[GA]A[GA]A-3' consensus sequence. Represses transcription by recruiting the chromatin multiprotein complex NuRD to target promoters. Negatively regulates expression of EGFR, a gene involved in cell proliferation, survival and migration. Its ability to repress genes of the EGFR pathway suggest it may act as a tumor suppressor. Able to suppress breast carcinogenesis.; [Isoform 4]: Antagonizes the transcription repression by isoform 1 by competing for the binding of the NuRD complex. Does not bind DNA.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
13.52 | LDD0402 | [1] | |
|
STPyne Probe Info |
![]() |
K497(10.00) | LDD0277 | [2] | |
|
DBIA Probe Info |
![]() |
C322(0.95) | LDD0078 | [3] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [4] | |
|
IA-alkyne Probe Info |
![]() |
C377(0.00); C180(0.00) | LDD0036 | [4] | |
|
Lodoacetamide azide Probe Info |
![]() |
C377(0.00); C224(0.00); C180(0.00) | LDD0037 | [4] | |
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [5] | |
|
Compound 10 Probe Info |
![]() |
C322(0.00); C377(0.00) | LDD2216 | [6] | |
|
Compound 11 Probe Info |
![]() |
C322(0.00); C377(0.00) | LDD2213 | [6] | |
|
IPM Probe Info |
![]() |
N.A. | LDD0147 | [7] | |
|
W1 Probe Info |
![]() |
N.A. | LDD0236 | [8] | |
|
NAIA_5 Probe Info |
![]() |
C224(0.00); C377(0.00); C180(0.00) | LDD2223 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0156 | Aniline | NCI-H1299 | 12.85 | LDD0403 | [1] |
| LDCM0020 | ARS-1620 | HCC44 | C322(0.95) | LDD0078 | [3] |
| LDCM0632 | CL-Sc | Hep-G2 | C180(20.00); C377(0.56) | LDD2227 | [5] |
| LDCM0572 | Fragment10 | Ramos | C377(0.49) | LDD2189 | [9] |
| LDCM0573 | Fragment11 | Ramos | C377(7.30) | LDD2190 | [9] |
| LDCM0574 | Fragment12 | Ramos | C377(0.72) | LDD2191 | [9] |
| LDCM0575 | Fragment13 | Ramos | C377(0.78) | LDD2192 | [9] |
| LDCM0576 | Fragment14 | Ramos | C377(0.82) | LDD2193 | [9] |
| LDCM0580 | Fragment21 | Ramos | C377(0.76) | LDD2195 | [9] |
| LDCM0582 | Fragment23 | Ramos | C377(1.02) | LDD2196 | [9] |
| LDCM0578 | Fragment27 | Ramos | C377(0.98) | LDD2197 | [9] |
| LDCM0588 | Fragment30 | Ramos | C377(0.81) | LDD2199 | [9] |
| LDCM0589 | Fragment31 | Ramos | C377(0.71) | LDD2200 | [9] |
| LDCM0590 | Fragment32 | Ramos | C377(0.68) | LDD2201 | [9] |
| LDCM0468 | Fragment33 | Ramos | C377(0.73) | LDD2202 | [9] |
| LDCM0596 | Fragment38 | Ramos | C377(0.58) | LDD2203 | [9] |
| LDCM0566 | Fragment4 | Ramos | C377(0.94) | LDD2184 | [9] |
| LDCM0610 | Fragment52 | Ramos | C377(1.05) | LDD2204 | [9] |
| LDCM0614 | Fragment56 | Ramos | C377(0.93) | LDD2205 | [9] |
| LDCM0569 | Fragment7 | Ramos | C377(1.13) | LDD2186 | [9] |
| LDCM0022 | KB02 | Ramos | C377(1.24) | LDD2182 | [9] |
| LDCM0023 | KB03 | Ramos | C377(1.03) | LDD2183 | [9] |
| LDCM0024 | KB05 | MEWO | C377(2.96) | LDD3319 | [10] |
| LDCM0112 | W16 | Hep-G2 | C377(0.52) | LDD0239 | [8] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Transcription factor
Other
References












