Details of the Target

General Information of Target

Target ID LDTP08890
Target Name Zinc finger CCCH-type with G patch domain-containing protein (ZGPAT)
Gene Name ZGPAT
Gene ID 84619
Synonyms
GPATC6; GPATCH6; KIAA1847; ZC3H9; ZC3HDC9; ZIP; Zinc finger CCCH-type with G patch domain-containing protein; G patch domain-containing protein 6; Zinc finger CCCH domain-containing protein 9; Zinc finger and G patch domain-containing protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDEESLESALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELTEASLVSVRKS
SLLAALDEERPGRQEDAEYQAFREAITEAVEAPAAARGSGSETVPKAEAGPESAAGGQEE
EEGEDEEELSGTKVSAPYYSSWGTLEYHNAMVVGTEEAEDGSAGVRVLYLYPTHKSLKPC
PFFLEGKCRFKENCRFSHGQVVSLDELRPFQDPDLSSLQAGSACLAKHQDGLWHAARITD
VDNGYYTVKFDSLLLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSA
QSSALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRV
EPIHAVVLPRGKSLDQCVETLQKQTRVGKAGTNKPPRCRGRGARPGGRPAPRNVFDFLNE
KLQGQAPGALEAGAAPAGRRSKDMYHASKSAKRALSLRLFQTEEKIERTQRDIRSIQEAL
ARNAGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF
Target Bioclass
Transcription factor
Subcellular location
Nucleus
Function
Transcription repressor that specifically binds the 5'-GGAG[GA]A[GA]A-3' consensus sequence. Represses transcription by recruiting the chromatin multiprotein complex NuRD to target promoters. Negatively regulates expression of EGFR, a gene involved in cell proliferation, survival and migration. Its ability to repress genes of the EGFR pathway suggest it may act as a tumor suppressor. Able to suppress breast carcinogenesis.; [Isoform 4]: Antagonizes the transcription repression by isoform 1 by competing for the binding of the NuRD complex. Does not bind DNA.
Uniprot ID
Q8N5A5
Ensemble ID
ENST00000328969.5
HGNC ID
HGNC:15948

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 12 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		13.52  LDD0402  [1]
STPyne
 Probe Info  		K497(10.00)  LDD0277  [2]
DBIA
 Probe Info  		C322(0.95)  LDD0078  [3]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [4]
IA-alkyne
 Probe Info  		C377(0.00); C180(0.00)  LDD0036  [4]
Lodoacetamide azide
 Probe Info  		C377(0.00); C224(0.00); C180(0.00)  LDD0037  [4]
NAIA_4
 Probe Info  		N.A.  LDD2226  [5]
Compound 10
 Probe Info  		C322(0.00); C377(0.00)  LDD2216  [6]
Compound 11
 Probe Info  		C322(0.00); C377(0.00)  LDD2213  [6]
IPM
 Probe Info  		N.A.  LDD0147  [7]
W1
 Probe Info  		N.A.  LDD0236  [8]
NAIA_5
 Probe Info  		C224(0.00); C377(0.00); C180(0.00)  LDD2223  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 12.85  LDD0403  [1]
 LDCM0020  ARS-1620 HCC44 C322(0.95)  LDD0078  [3]
 LDCM0632  CL-Sc Hep-G2 C180(20.00); C377(0.56)  LDD2227  [5]
 LDCM0572  Fragment10 Ramos C377(0.49)  LDD2189  [9]
 LDCM0573  Fragment11 Ramos C377(7.30)  LDD2190  [9]
 LDCM0574  Fragment12 Ramos C377(0.72)  LDD2191  [9]
 LDCM0575  Fragment13 Ramos C377(0.78)  LDD2192  [9]
 LDCM0576  Fragment14 Ramos C377(0.82)  LDD2193  [9]
 LDCM0580  Fragment21 Ramos C377(0.76)  LDD2195  [9]
 LDCM0582  Fragment23 Ramos C377(1.02)  LDD2196  [9]
 LDCM0578  Fragment27 Ramos C377(0.98)  LDD2197  [9]
 LDCM0588  Fragment30 Ramos C377(0.81)  LDD2199  [9]
 LDCM0589  Fragment31 Ramos C377(0.71)  LDD2200  [9]
 LDCM0590  Fragment32 Ramos C377(0.68)  LDD2201  [9]
 LDCM0468  Fragment33 Ramos C377(0.73)  LDD2202  [9]
 LDCM0596  Fragment38 Ramos C377(0.58)  LDD2203  [9]
 LDCM0566  Fragment4 Ramos C377(0.94)  LDD2184  [9]
 LDCM0610  Fragment52 Ramos C377(1.05)  LDD2204  [9]
 LDCM0614  Fragment56 Ramos C377(0.93)  LDD2205  [9]
 LDCM0569  Fragment7 Ramos C377(1.13)  LDD2186  [9]
 LDCM0022  KB02 Ramos C377(1.24)  LDD2182  [9]
 LDCM0023  KB03 Ramos C377(1.03)  LDD2183  [9]
 LDCM0024  KB05 MEWO C377(2.96)  LDD3319  [10]
 LDCM0112  W16 Hep-G2 C377(0.52)  LDD0239  [8]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ATP-dependent RNA helicase DHX15 (DHX15) DEAD box helicase family O43143
Kinesin-like protein KIFC3 (KIFC3) Kinesin family Q9BVG8
Tripartite motif-containing protein 14 (TRIM14) TRIM/RBCC family Q14142
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Leucine zipper putative tumor suppressor 1 (LZTS1) LZTS family Q9Y250
Protein S100-A10 (S100A10) S-100 family P60903
Optineurin (OPTN) . Q96CV9
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Transcription factor
Click To Hide/Show 17 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein Aiolos (IKZF3) Ikaros C2H2-type zinc-finger protein family Q9UKT9
Endothelial zinc finger protein induced by tumor necrosis factor alpha (ZNF71) Krueppel C2H2-type zinc-finger protein family Q9NQZ8
Zinc finger and SCAN domain-containing protein 22 (ZSCAN22) Krueppel C2H2-type zinc-finger protein family P10073
Zinc finger protein 24 (ZNF24) Krueppel C2H2-type zinc-finger protein family P17028
Zinc finger protein 329 (ZNF329) Krueppel C2H2-type zinc-finger protein family Q86UD4
Zinc finger protein 35 (ZNF35) Krueppel C2H2-type zinc-finger protein family P13682
Zinc finger protein 587 (ZNF587) Krueppel C2H2-type zinc-finger protein family Q96SQ5
Zinc finger protein 688 (ZNF688) Krueppel C2H2-type zinc-finger protein family P0C7X2
THAP domain-containing protein 1 (THAP1) THAP1 family Q9NVV9
Zinc finger C2HC domain-containing protein 1B (ZC2HC1B) ZC2HC1 family Q5TFG8
Zinc finger X-linked protein ZXDB (ZXDB) ZXD family P98169
Golgin-45 (BLZF1) . Q9H2G9
THAP domain-containing protein 6 (THAP6) . Q8TBB0
Transcription factor 19 (TCF19) . Q9Y242
Transcriptional repressor p66-beta (GATAD2B) . Q8WXI9
Zinc finger and BTB domain-containing protein 8A (ZBTB8A) . Q96BR9
Zinc finger protein 426 (ZNF426) . Q9BUY5
Other
Click To Hide/Show 35 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Afadin- and alpha-actinin-binding protein (SSX2IP) ADIP family Q9Y2D8
Angiomotin-like protein 2 (AMOTL2) Angiomotin family Q9Y2J4
Apoptosis-stimulating of p53 protein 1 (PPP1R13B) ASPP family Q96KQ4
Nuclear nucleic acid-binding protein C1D (C1D) C1D family Q13901
Caveolae-associated protein 4 (CAVIN4) CAVIN family Q5BKX8
Cyclin-D1-binding protein 1 (CCNDBP1) CCNDBP1 family O95273
Cerebellar degeneration-related protein 2 (CDR2) CDR2 family Q01850
Connector enhancer of kinase suppressor of ras 1 (CNKSR1) CNKSR family Q969H4
DPY30 domain-containing protein 1 (DYDC1) Dpy-30 family Q8WWB3
Protein FAM9B (FAM9B) FAM9 family Q8IZU0
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cytoskeletal 15 (KRT15) Intermediate filament family P19012
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Lebercilin-like protein (LCA5L) LCA5 family O95447
Protein LDOC1 (LDOC1) LDOC1 family O95751
Leucine zipper putative tumor suppressor 2 (LZTS2) LZTS2 family Q9BRK4
Meiosis-specific nuclear structural protein 1 (MNS1) MNS1 family Q8NEH6
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9
U2 small nuclear ribonucleoprotein A' (SNRPA1) U2 small nuclear ribonucleoprotein A family P09661
TLE family member 5 (TLE5) WD repeat Groucho/TLE family Q08117
Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (AIMP2) . Q13155
BEN domain-containing protein 5 (BEND5) . Q7L4P6
Cell division cycle-associated 7-like protein (CDCA7L) . Q96GN5
Centrosomal protein of 70 kDa (CEP70) . Q8NHQ1
Coiled-coil domain-containing protein 13 (CCDC13) . Q8IYE1
Coiled-coil domain-containing protein 57 (CCDC57) . Q2TAC2
Heat shock factor 2-binding protein (HSF2BP) . O75031
Mirror-image polydactyly gene 1 protein (MIPOL1) . Q8TD10
Nebulette (NEBL) . O76041
Polyhomeotic-like protein 2 (PHC2) . Q8IXK0
Protein hinderin (KIAA1328) . Q86T90
SERTA domain-containing protein 3 (SERTAD3) . Q9UJW9
SH3 and cysteine-rich domain-containing protein 3 (STAC3) . Q96MF2

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
4 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
5 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
6 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279
7 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
8 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
9 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
10 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840