Details of the Target
General Information of Target
Target ID | LDTP08787 | |||||
---|---|---|---|---|---|---|
Target Name | Histone H2B type 3-B (H2BC26) | |||||
Gene Name | H2BC26 | |||||
Gene ID | 128312 | |||||
Synonyms |
H2BU1; HIST3H2BB; Histone H2B type 3-B; H2B type 12; H2B-clustered histone 26; H2B.U histone 1 |
|||||
3D Structure | ||||||
Sequence |
MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK |
|||||
Target Bioclass |
Other
|
|||||
Family |
Histone H2B family
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
ONAyne Probe Info |
![]() |
N.A. | LDD0273 | [1] | |
HHS-475 Probe Info |
![]() |
Y84(1.13) | LDD0264 | [2] | |
HHS-465 Probe Info |
![]() |
Y84(2.95) | LDD2237 | [3] | |
aONE Probe Info |
![]() |
K117(0.00); K109(0.00) | LDD0002 | [4] | |
NHS Probe Info |
![]() |
K47(0.00); K58(0.00); K109(0.00); K6(0.00) | LDD0010 | [4] | |
SF Probe Info |
![]() |
K86(0.00); K35(0.00); Y84(0.00); Y41(0.00) | LDD0028 | [5] |
Competitor(s) Related to This Target
References