General Information of Target

Target ID LDTP08675
Target Name E3 ubiquitin-protein ligase RNF168 (RNF168)
Gene Name RNF168
Gene ID 165918
Synonyms
E3 ubiquitin-protein ligase RNF168; hRNF168; EC 2.3.2.27; RING finger protein 168; RING-type E3 ubiquitin transferase RNF168
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MALPKDAIPSLSECQCGICMEILVEPVTLPCNHTLCKPCFQSTVEKASLCCPFCRRRVSS
WTRYHTRRNSLVNVELWTIIQKHYPRECKLRASGQESEEVADDYQPVRLLSKPGELRREY
EEEISKVAAERRASEEEENKASEEYIQRLLAEEEEEEKRQAEKRRRAMEEQLKSDEELAR
KLSIDINNFCEGSISASPLNSRKSDPVTPKSEKKSKNKQRNTGDIQKYLTPKSQFGSASH
SEAVQEVRKDSVSKDIDSSDRKSPTGQDTEIEDMPTLSPQISLGVGEQGADSSIESPMPW
LCACGAEWYHEGNVKTRPSNHGKELCVLSHERPKTRVPYSKETAVMPCGRTESGCAPTSG
VTQTNGNNTGETENEESCLLISKEISKRKNQESSFEAVKDPCFSAKRRKVSPESSPDQEE
TEINFTQKLIDLEHLLFERHKQEEQDRLLALQLQKEVDKEQMVPNRQKGSPDEYHLRATS
SPPDKVLNGQRKNPKDGNFKRQTHTKHPTPERGSRDKNRQVSLKMQLKQSVNRRKMPNST
RDHCKVSKSAHSLQPSISQKSVFQMFQRCTK
Target Bioclass
Enzyme
Family
RNF168 family
Subcellular location
Nucleus
Function
E3 ubiquitin-protein ligase required for accumulation of repair proteins to sites of DNA damage. Acts with UBE2N/UBC13 to amplify the RNF8-dependent histone ubiquitination. Recruited to sites of DNA damage at double-strand breaks (DSBs) by binding to ubiquitinated histone H2A and H2AX and amplifies the RNF8-dependent H2A ubiquitination, promoting the formation of 'Lys-63'-linked ubiquitin conjugates. This leads to concentrate ubiquitinated histones H2A and H2AX at DNA lesions to the threshold required for recruitment of TP53BP1 and BRCA1. Also recruited at DNA interstrand cross-links (ICLs) sites and promotes accumulation of 'Lys-63'-linked ubiquitination of histones H2A and H2AX, leading to recruitment of FAAP20/C1orf86 and Fanconi anemia (FA) complex, followed by interstrand cross-link repair. H2A ubiquitination also mediates the ATM-dependent transcriptional silencing at regions flanking DSBs in cis, a mechanism to avoid collision between transcription and repair intermediates. Also involved in class switch recombination in immune system, via its role in regulation of DSBs repair. Following DNA damage, promotes the ubiquitination and degradation of JMJD2A/KDM4A in collaboration with RNF8, leading to unmask H4K20me2 mark and promote the recruitment of TP53BP1 at DNA damage sites. Not able to initiate 'Lys-63'-linked ubiquitination in vitro; possibly due to partial occlusion of the UBE2N/UBC13-binding region. Catalyzes monoubiquitination of 'Lys-13' and 'Lys-15' of nucleosomal histone H2A (H2AK13Ub and H2AK15Ub, respectively). {|HAMAP-Rule:MF_03066}.
Uniprot ID
Q8IYW5
Ensemble ID
ENST00000318037.3
HGNC ID
HGNC:26661
ChEMBL ID
CHEMBL5169175

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C355(2.90); C378(2.90)  LDD0080  [1]
m-APA
 Probe Info 
N.A.  LDD2234  [2]
4-Iodoacetamidophenylacetylene
 Probe Info 
N.A.  LDD0038  [3]
IA-alkyne
 Probe Info 
N.A.  LDD2241  [3]
Lodoacetamide azide
 Probe Info 
N.A.  LDD0037  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0237  AC12 HEK-293T C190(0.67); C348(0.97); C39(1.00)  LDD1510  [4]
 LDCM0259  AC14 HEK-293T C190(0.85)  LDD1512  [4]
 LDCM0280  AC20 HEK-293T C190(0.72); C348(0.87); C39(1.00)  LDD1519  [4]
 LDCM0281  AC21 HEK-293T C190(1.26); C39(0.87)  LDD1520  [4]
 LDCM0282  AC22 HEK-293T C190(1.70)  LDD1521  [4]
 LDCM0288  AC28 HEK-293T C190(0.89); C348(1.07); C39(0.92)  LDD1527  [4]
 LDCM0289  AC29 HEK-293T C190(1.15); C39(0.98)  LDD1528  [4]
 LDCM0291  AC30 HEK-293T C190(1.07)  LDD1530  [4]
 LDCM0297  AC36 HEK-293T C190(0.80); C348(0.93); C39(1.00)  LDD1536  [4]
 LDCM0298  AC37 HEK-293T C190(0.99); C39(0.95)  LDD1537  [4]
 LDCM0299  AC38 HEK-293T C190(0.97)  LDD1538  [4]
 LDCM0301  AC4 HEK-293T C190(0.76); C348(0.81); C39(0.93)  LDD1540  [4]
 LDCM0306  AC44 HEK-293T C190(0.90); C348(0.94); C39(0.98)  LDD1545  [4]
 LDCM0307  AC45 HEK-293T C190(0.82); C39(0.92)  LDD1546  [4]
 LDCM0308  AC46 HEK-293T C190(1.19)  LDD1547  [4]
 LDCM0312  AC5 HEK-293T C190(1.33); C39(0.98)  LDD1551  [4]
 LDCM0315  AC52 HEK-293T C190(0.77); C348(0.98); C39(1.03)  LDD1554  [4]
 LDCM0316  AC53 HEK-293T C190(0.94); C39(1.09)  LDD1555  [4]
 LDCM0317  AC54 HEK-293T C190(0.96)  LDD1556  [4]
 LDCM0323  AC6 HEK-293T C190(1.00)  LDD1562  [4]
 LDCM0324  AC60 HEK-293T C190(0.64); C348(0.98); C39(0.93)  LDD1563  [4]
 LDCM0325  AC61 HEK-293T C190(1.07); C39(0.96)  LDD1564  [4]
 LDCM0326  AC62 HEK-293T C190(0.96)  LDD1565  [4]
 LDCM0248  AKOS034007472 HEK-293T C190(1.06); C39(0.99)  LDD1511  [4]
 LDCM0367  CL1 HEK-293T C190(1.13)  LDD1571  [4]
 LDCM0368  CL10 HEK-293T C190(1.84)  LDD1572  [4]
 LDCM0370  CL101 HEK-293T C190(1.07)  LDD1574  [4]
 LDCM0374  CL105 HEK-293T C190(0.91)  LDD1578  [4]
 LDCM0378  CL109 HEK-293T C190(0.97)  LDD1582  [4]
 LDCM0383  CL113 HEK-293T C190(1.02)  LDD1587  [4]
 LDCM0387  CL117 HEK-293T C190(1.04)  LDD1591  [4]
 LDCM0392  CL121 HEK-293T C190(1.00)  LDD1596  [4]
 LDCM0396  CL125 HEK-293T C190(1.06)  LDD1600  [4]
 LDCM0400  CL13 HEK-293T C190(1.05)  LDD1604  [4]
 LDCM0408  CL20 HEK-293T C190(0.72); C348(1.03); C39(1.34)  LDD1612  [4]
 LDCM0409  CL21 HEK-293T C190(1.06); C39(0.97)  LDD1613  [4]
 LDCM0410  CL22 HEK-293T C190(3.69)  LDD1614  [4]
 LDCM0413  CL25 HEK-293T C190(1.02)  LDD1617  [4]
 LDCM0421  CL32 HEK-293T C190(0.70); C348(0.93); C39(1.38)  LDD1625  [4]
 LDCM0422  CL33 HEK-293T C190(1.09); C39(0.87)  LDD1626  [4]
 LDCM0423  CL34 HEK-293T C190(1.51)  LDD1627  [4]
 LDCM0426  CL37 HEK-293T C190(1.15)  LDD1630  [4]
 LDCM0434  CL44 HEK-293T C190(0.78); C348(0.91); C39(1.18)  LDD1638  [4]
 LDCM0435  CL45 HEK-293T C190(1.32); C39(0.97)  LDD1639  [4]
 LDCM0436  CL46 HEK-293T C190(2.22)  LDD1640  [4]
 LDCM0439  CL49 HEK-293T C190(0.90)  LDD1643  [4]
 LDCM0447  CL56 HEK-293T C190(0.87); C348(0.88); C39(1.26)  LDD1650  [4]
 LDCM0448  CL57 HEK-293T C190(1.04); C39(0.94)  LDD1651  [4]
 LDCM0449  CL58 HEK-293T C190(1.95)  LDD1652  [4]
 LDCM0453  CL61 HEK-293T C190(1.05)  LDD1656  [4]
 LDCM0460  CL68 HEK-293T C190(0.72); C348(0.82); C39(1.35)  LDD1663  [4]
 LDCM0461  CL69 HEK-293T C190(1.23); C39(0.94)  LDD1664  [4]
 LDCM0463  CL70 HEK-293T C190(1.75)  LDD1666  [4]
 LDCM0466  CL73 HEK-293T C190(0.94)  LDD1669  [4]
 LDCM0473  CL8 HEK-293T C190(0.67); C348(1.03); C39(1.05)  LDD1676  [4]
 LDCM0474  CL80 HEK-293T C190(0.72); C348(1.03); C39(1.23)  LDD1677  [4]
 LDCM0475  CL81 HEK-293T C190(1.13); C39(1.03)  LDD1678  [4]
 LDCM0476  CL82 HEK-293T C190(1.71)  LDD1679  [4]
 LDCM0479  CL85 HEK-293T C190(1.03)  LDD1682  [4]
 LDCM0484  CL9 HEK-293T C190(1.42); C39(1.13)  LDD1687  [4]
 LDCM0487  CL92 HEK-293T C190(0.76); C348(1.11); C39(1.12)  LDD1690  [4]
 LDCM0488  CL93 HEK-293T C190(0.97); C39(0.99)  LDD1691  [4]
 LDCM0489  CL94 HEK-293T C190(1.82)  LDD1692  [4]
 LDCM0492  CL97 HEK-293T C190(0.95)  LDD1695  [4]
 LDCM0022  KB02 HCT 116 C355(2.90); C378(2.90)  LDD0080  [1]
 LDCM0023  KB03 HCT 116 C355(2.29); C378(2.29)  LDD0081  [1]
 LDCM0024  KB05 HCT 116 C355(2.18); C378(2.18)  LDD0082  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5-aminolevulinate synthase, non-specific, mitochondrial (ALAS1) Class-II pyridoxal-phosphate-dependent aminotransferase family P13196
E3 ubiquitin-protein ligase TRIM8 (TRIM8) TRIM/RBCC family Q9BZR9
Ubiquitin-conjugating enzyme E2 N (UBE2N) Ubiquitin-conjugating enzyme family P61088
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-synuclein (SNCA) Synuclein family P37840
Wolframin (WFS1) . O76024
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Histone H1.0 (H1-0) Histone H1/H5 family P07305
RING finger protein 11 (RNF11) . Q9Y3C5

References

1 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
2 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
3 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
4 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402