Details of the Target
General Information of Target
| Target ID | LDTP07668 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ubiquinol-cytochrome-c reductase complex assembly factor 3 (UQCC3) | |||||
| Gene Name | UQCC3 | |||||
| Gene ID | 790955 | |||||
| Synonyms |
C11orf83; Ubiquinol-cytochrome-c reductase complex assembly factor 3; Assembly factor CBP4 homolog |
|||||
| 3D Structure | ||||||
| Sequence |
MDSLRKMLISVAMLGAGAGVGYALLVIVTPGERRKQEMLKEMPLQDPRSREEAARTQQLL
LATLQEAATTQENVAWRKNWMVGGEGGAGGRSP |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
UQCC3 family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function |
Required for the assembly of the ubiquinol-cytochrome c reductase complex (mitochondrial respiratory chain complex III or cytochrome b-c1 complex), mediating cytochrome b recruitment and probably stabilization within the complex. Thereby, plays an important role in ATP production by mitochondria. Cardiolipin-binding protein, it may also control the cardiolipin composition of mitochondria membranes and their morphology.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
N1 Probe Info |
 |
S92(0.00); R91(0.00) | LDD0245 | [1] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C094 Probe Info |
 |
24.08 | LDD1785 | [2] | |
References