Details of the Target
General Information of Target
| Target ID | LDTP07613 | |||||
|---|---|---|---|---|---|---|
| Target Name | Complexin-2 (CPLX2) | |||||
| Gene Name | CPLX2 | |||||
| Gene ID | 10814 | |||||
| Synonyms |
Complexin-2; Complexin II; CPX II; Synaphin-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAERE
KVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTV LKYLPGPLQDMFKK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Complexin/synaphin family
|
|||||
| Subcellular location |
Cytoplasm, cytosol
|
|||||
| Function |
Negatively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. Positively regulates a late step in exocytosis of various cytoplasmic vesicles, such as synaptic vesicles and other secretory vesicles. Also involved in mast cell exocytosis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
 |
N.A. | LDD0241 | [1] | |
|
DBIA Probe Info |
 |
C90(2.09) | LDD3342 | [2] | |
|
IA-alkyne Probe Info |
 |
C90(0.00); C105(0.00) | LDD0162 | [3] | |
|
WYneC Probe Info |
 |
N.A. | LDD0014 | [4] | |
|
WYneN Probe Info |
 |
C90(0.00); C105(0.00) | LDD0021 | [4] | |
|
WYneO Probe Info |
 |
N.A. | LDD0022 | [4] | |
|
W1 Probe Info |
 |
N.A. | LDD0236 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References