Details of the Target

General Information of Target

Target ID LDTP07482
Target Name Inactive Ufm1-specific protease 1 (UFSP1)
Gene Name UFSP1
Gene ID 402682
Synonyms
Inactive Ufm1-specific protease 1; UfSP1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGDKPPGFRGSRDWIGCVEASLCLAHFGGPQGRLCHVPRGVGLHGELERLYSHFAGGGGP
VMVGGDADARSKALLGVCVGSGTEAYVLVLDPHYWGTPKSPSELQAAGWVGWQEVSAAFD
PNSFYNLCLTSLSSQQQQRTLD
Target Bioclass
Enzyme
Family
Peptidase C78 family
Uniprot ID
Q6NVU6
Ensemble ID
ENST00000388761.4
HGNC ID
HGNC:33821

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C35(1.25)  LDD3311  [1]
NAIA_4
 Probe Info  		N.A.  LDD2226  [2]
IPM
 Probe Info  		N.A.  LDD0005  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0226  AC11 HEK-293T C23(1.11)  LDD1509  [4]
 LDCM0278  AC19 HEK-293T C23(1.00)  LDD1517  [4]
 LDCM0284  AC24 HEK-293T C23(1.15)  LDD1523  [4]
 LDCM0287  AC27 HEK-293T C23(1.01)  LDD1526  [4]
 LDCM0290  AC3 HEK-293T C23(0.86)  LDD1529  [4]
 LDCM0293  AC32 HEK-293T C23(0.72)  LDD1532  [4]
 LDCM0296  AC35 HEK-293T C23(1.15)  LDD1535  [4]
 LDCM0302  AC40 HEK-293T C23(1.00)  LDD1541  [4]
 LDCM0305  AC43 HEK-293T C23(0.99)  LDD1544  [4]
 LDCM0310  AC48 HEK-293T C23(1.20)  LDD1549  [4]
 LDCM0314  AC51 HEK-293T C23(0.92)  LDD1553  [4]
 LDCM0319  AC56 HEK-293T C23(1.03)  LDD1558  [4]
 LDCM0322  AC59 HEK-293T C23(0.98)  LDD1561  [4]
 LDCM0328  AC64 HEK-293T C23(1.09)  LDD1567  [4]
 LDCM0345  AC8 HEK-293T C23(0.70)  LDD1569  [4]
 LDCM0275  AKOS034007705 HEK-293T C23(0.96)  LDD1514  [4]
 LDCM0390  CL12 HEK-293T C23(1.51)  LDD1594  [4]
 LDCM0406  CL19 HEK-293T C23(1.03)  LDD1610  [4]
 LDCM0412  CL24 HEK-293T C23(1.42)  LDD1616  [4]
 LDCM0420  CL31 HEK-293T C23(1.28)  LDD1624  [4]
 LDCM0425  CL36 HEK-293T C23(0.21)  LDD1629  [4]
 LDCM0433  CL43 HEK-293T C23(0.72)  LDD1637  [4]
 LDCM0438  CL48 HEK-293T C23(0.59)  LDD1642  [4]
 LDCM0446  CL55 HEK-293T C23(0.76)  LDD1649  [4]
 LDCM0452  CL60 HEK-293T C23(0.89)  LDD1655  [4]
 LDCM0459  CL67 HEK-293T C23(1.12)  LDD1662  [4]
 LDCM0462  CL7 HEK-293T C23(1.06)  LDD1665  [4]
 LDCM0465  CL72 HEK-293T C23(0.76)  LDD1668  [4]
 LDCM0472  CL79 HEK-293T C23(0.89)  LDD1675  [4]
 LDCM0478  CL84 HEK-293T C23(1.67)  LDD1681  [4]
 LDCM0486  CL91 HEK-293T C23(1.05)  LDD1689  [4]
 LDCM0491  CL96 HEK-293T C23(0.68)  LDD1694  [4]
 LDCM0022  KB02 42-MG-BA C35(1.48)  LDD2244  [1]
 LDCM0023  KB03 42-MG-BA C35(2.57)  LDD2661  [1]
 LDCM0024  KB05 G361 C35(1.25)  LDD3311  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Maspardin (SPG21) AB hydrolase superfamily Q9NZD8
Glycerate kinase (GLYCTK) Glycerate kinase type-2 family Q8IVS8
E3 ubiquitin-protein ligase FANCL (FANCL) . Q9NW38
Transcription factor
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-C9 (HOXC9) Abd-B homeobox family P31274
Ventral anterior homeobox 2 (VAX2) EMX homeobox family Q9UIW0
Zinc finger protein ZIC 1 (ZIC1) GLI C2H2-type zinc-finger protein family Q15915
Hepatocyte nuclear factor 1-beta (HNF1B) HNF1 homeobox family P35680
Homeobox protein prophet of Pit-1 (PROP1) Paired homeobox family O75360
Pituitary homeobox 1 (PITX1) Paired homeobox family P78337
POU domain, class 6, transcription factor 2 (POU6F2) POU transcription factor family P78424
SWI/SNF complex subunit SMARCC1 (SMARCC1) SMARCC family Q92922
Forkhead box protein H1 (FOXH1) . O75593
Pogo transposable element with ZNF domain (POGZ) . Q7Z3K3
T-box transcription factor TBX3 (TBX3) . O15119
T-cell leukemia homeobox protein 3 (TLX3) . O43711
Other
Click To Hide/Show 16 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Lipid transferase CIDEB (CIDEB) CIDE family Q9UHD4
Lipid transferase CIDEC (CIDEC) CIDE family Q96AQ7
Conserved oligomeric Golgi complex subunit 6 (COG6) COG6 family Q9Y2V7
Protein FAM222B (FAM222B) FAM222 family Q8WU58
Protein INCA1 (INCA1) INCA family Q0VD86
Myozenin-3 (MYOZ3) Myozenin family Q8TDC0
Keratin-associated protein 15-1 (KRTAP15-1) PMG family Q3LI76
U1 small nuclear ribonucleoprotein C (SNRPC) U1 small nuclear ribonucleoprotein C family P09234
Protein VAC14 homolog (VAC14) VAC14 family Q08AM6
Vacuolar protein sorting-associated protein 37C (VPS37C) VPS37 family A5D8V6
AP-4 complex accessory subunit RUSC1 (RUSC1) . Q9BVN2
Cleavage stimulation factor subunit 2 (CSTF2) . P33240
G-protein-signaling modulator 3 (GPSM3) . Q9Y4H4
RNA-binding protein with multiple splicing 2 (RBPMS2) . Q6ZRY4
Ubiquilin-2 (UBQLN2) . Q9UHD9
Uncharacterized protein C10orf55 (C10orf55) . Q5SWW7

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
3 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
4 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402