Details of the Target
General Information of Target
| Target ID | LDTP07049 | |||||
|---|---|---|---|---|---|---|
| Target Name | Histone H2B type 2-F (H2BC18) | |||||
| Gene Name | H2BC18 | |||||
| Gene ID | 440689 | |||||
| Synonyms |
HIST2H2BF; Histone H2B type 2-F; H2B-clustered histone 18 |
|||||
| 3D Structure | ||||||
| Sequence |
MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Histone H2B family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C-Sul Probe Info |
![]() |
2.60 | LDD0066 | [1] | |
|
ONAyne Probe Info |
![]() |
N.A. | LDD0273 | [2] | |
|
DBIA Probe Info |
![]() |
C84(1.21) | LDD2408 | [3] | |
|
HHS-475 Probe Info |
![]() |
Y84(1.13) | LDD0264 | [4] | |
|
HHS-465 Probe Info |
![]() |
Y84(2.95) | LDD2237 | [5] | |
|
Alkyne tyramide Probe Info |
![]() |
K117(0.00); K121(0.00); K47(0.00); K86(0.00) | LDD0003 | [6] | |
|
ATP probe Probe Info |
![]() |
K86(0.00); K35(0.00) | LDD0035 | [7] | |
|
NHS Probe Info |
![]() |
K35(0.00); K109(0.00); K6(0.00); K117(0.00) | LDD0010 | [6] | |
|
STPyne Probe Info |
![]() |
K35(0.00); K109(0.00) | LDD0009 | [6] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STS-1 Probe Info |
![]() |
N.A. | LDD0136 | [8] | |
|
STS-2 Probe Info |
![]() |
N.A. | LDD0138 | [8] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0116 | HHS-0101 | DM93 | Y84(1.13) | LDD0264 | [4] |
| LDCM0117 | HHS-0201 | DM93 | Y84(1.00) | LDD0265 | [4] |
| LDCM0118 | HHS-0301 | DM93 | Y84(1.27) | LDD0266 | [4] |
| LDCM0119 | HHS-0401 | DM93 | Y84(1.26) | LDD0267 | [4] |
| LDCM0120 | HHS-0701 | DM93 | Y84(1.74) | LDD0268 | [4] |
| LDCM0022 | KB02 | JM-1 | C84(1.21) | LDD2408 | [3] |
| LDCM0024 | KB05 | JM-1 | C84(1.77) | LDD3242 | [3] |
References











