Details of the Target

General Information of Target

Target ID LDTP06947
Target Name Transmembrane protein 128 (TMEM128)
Gene Name TMEM128
Gene ID 85013
Synonyms
Transmembrane protein 128
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDSSRARQQLRRRFLLLPDAEAQLDREGDAGPETSTAVEKKEKPLPRLNIHSGFWILASI
VVTYYVDFFKTLKENFHTSSWFLCGSALLLVSLSIAFYCIVYLEWYCGIGEYDVKYPALI
PITTASFIAAGICFNIALWHVWSFFTPLLLFTQFMGVVMFITLLG
Target Bioclass
Transporter and channel
Subcellular location
Membrane
Uniprot ID
Q5BJH2
Ensemble ID
ENST00000254742.6
HGNC ID
HGNC:28201

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
COLO792 SNV: p.R5L .

Probe(s) Labeling This Target

PAL-AfBPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C383
 Probe Info  		12.21  LDD2042  [1]
C388
 Probe Info  		70.52  LDD2047  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Palmitoyltransferase ZDHHC15 (ZDHHC15) DHHC palmitoyltransferase family Q96MV8
Very long chain fatty acid elongase 4 (ELOVL4) ELO family Q9GZR5
Probable glutathione peroxidase 8 (GPX8) Glutathione peroxidase family Q8TED1
Glutamate decarboxylase 2 (GAD2) Group II decarboxylase family Q05329
Signal peptidase complex catalytic subunit SEC11C (SEC11C) Peptidase S26B family Q9BY50
Estradiol 17-beta-dehydrogenase 11 (HSD17B11) Short-chain dehydrogenases/reductases (SDR) family Q8NBQ5
ADP-ribosylation factor-like protein 13B (ARL13B) Arf family Q3SXY8
Transmembrane ascorbate-dependent reductase CYB561 (CYB561) . P49447
Transporter and channel
Click To Hide/Show 18 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Solute carrier family 7 member 14 (SLC7A14) Cationic amino acid transporter (CAT) (TC 2.A.3.3) family Q8TBB6
Bestrophin-2 (BEST2) Anion channel-forming bestrophin family Q8NFU1
Sodium-dependent organic anion transporter (SLC10A6) Bile acid:sodium symporter (BASS) family Q3KNW5
Claudin-5 (CLDN5) Claudin family O00501
Claudin-7 (CLDN7) Claudin family O95471
Gap junction alpha-1 protein (GJA1) Connexin family P17302
Gap junction alpha-8 protein (GJA8) Connexin family P48165
Excitatory amino acid transporter 1 (SLC1A3) Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family P43003
LHFPL tetraspan subfamily member 5 protein (LHFPL5) LHFP family Q8TAF8
Molybdate-anion transporter (MFSD5) Major facilitator superfamily Q6N075
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Sodium channel regulatory subunit beta-3 (SCN3B) Sodium channel auxiliary subunit SCN3B family Q9NY72
Syntaxin-1A (STX1A) Syntaxin family Q16623
Leukocyte surface antigen CD53 (CD53) Tetraspanin (TM4SF) family P19397
Transmembrane protein 106A (TMEM106A) TMEM106 family Q96A25
Potassium channel subfamily K member 5 (KCNK5) Two pore domain potassium channel (TC 1.A.1.8) family O95279
Protrudin (ZFYVE27) . Q5T4F4
Thioredoxin-related transmembrane protein 2 (TMX2) . Q9Y320
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Paired-like homeodomain transcription factor LEUTX (LEUTX) Paired homeobox family A8MZ59
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Probable G-protein coupled receptor 152 (GPR152) G-protein coupled receptor 1 family Q8TDT2
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
B-cell antigen receptor complex-associated protein alpha chain (CD79A) . P11912
Cytokine and receptor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Interleukin-3 receptor subunit alpha (IL3RA) Type I cytokine receptor family P26951
Tumor necrosis factor receptor superfamily member 5 (CD40) . P25942
Other
Click To Hide/Show 20 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Small ribosomal subunit protein mS40 (MRPS18B) Bacterial ribosomal protein bS18 family Q9Y676
Bcl-2-like protein 13 (BCL2L13) Bcl-2 family Q9BXK5
Gap junction beta-5 protein (GJB5) Connexin family O95377
Cytochrome b-245 chaperone 1 (CYBC1) CYBC1 family Q9BQA9
Receptor expression-enhancing protein 4 (REEP4) DP1 family Q9H6H4
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Protein FAM209A (FAM209A) FAM209 family Q5JX71
RAB6-interacting golgin (GORAB) GORAB family Q5T7V8
Growth factor receptor-bound protein 2 (GRB2) GRB2/sem-5/DRK family P62993
Translation initiation factor IF-3, mitochondrial (MTIF3) IF-3 family Q9H2K0
Protein jagunal homolog 1 (JAGN1) Jagunal family Q8N5M9
LHFPL tetraspan subfamily member 2 protein (LHFPL2) LHFP family Q6ZUX7
Transcription termination factor 1, mitochondrial (MTERF1) MTERF family Q99551
Reticulophagy regulator 3 (RETREG3) RETREG family Q86VR2
Protein shisa-like-1 (SHISAL1) Shisa family Q3SXP7
Transmembrane protein 45B (TMEM45B) TMEM45 family Q96B21
Immediate early response 3-interacting protein 1 (IER3IP1) YOS1 family Q9Y5U9
Serine-rich single-pass membrane protein 1 (SSMEM1) . Q8WWF3
Transmembrane protein 52B (TMEM52B) . Q4KMG9
Transmembrane protein 80 (TMEM80) . Q96HE8

References

1 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587