Details of the Target
General Information of Target
| Target ID | LDTP06644 | |||||
|---|---|---|---|---|---|---|
| Target Name | Discoidin domain-containing receptor 2 (DDR2) | |||||
| Gene Name | DDR2 | |||||
| Gene ID | 4921 | |||||
| Synonyms |
NTRKR3; TKT; TYRO10; Discoidin domain-containing receptor 2; Discoidin domain receptor 2; EC 2.7.10.1; CD167 antigen-like family member B; Discoidin domain-containing receptor tyrosine kinase 2; Neurotrophic tyrosine kinase, receptor-related 3; Receptor protein-tyrosine kinase TKT; Tyrosine-protein kinase TYRO10; CD antigen CD167b
|
|||||
| 3D Structure | ||||||
| Sequence |
MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKY
GRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKI NYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRV ELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAVGYSMTEGLGQLTDGVSGLD DFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFK EVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFS EITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPD YQEPSRLIRKLPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSV PAVTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSAN QPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAVCITDDPLCMITEYMENG DLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK NYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWET FTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP SFQEIHLLLLQQGDE |
|||||
| Target Type |
Patented-recorded
|
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Protein kinase superfamily, Tyr protein kinase family, Insulin receptor subfamily
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Tyrosine kinase involved in the regulation of tissues remodeling. It functions as a cell surface receptor for fibrillar collagen and regulates cell differentiation, remodeling of the extracellular matrix, cell migration and cell proliferation. Required for normal bone development. Regulates osteoblast differentiation and chondrocyte maturation via a signaling pathway that involves MAP kinases and leads to the activation of the transcription factor RUNX2. Regulates remodeling of the extracellular matrix by up-regulation of the collagenases MMP1, MMP2 and MMP13, and thereby facilitates cell migration and tumor cell invasion. Promotes fibroblast migration and proliferation, and thereby contributes to cutaneous wound healing.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
FBPP2 Probe Info |
![]() |
7.36 | LDD0318 | [1] | |
|
DBIA Probe Info |
![]() |
C831(5.56); C716(3.71); C288(3.24) | LDD3310 | [2] | |
|
TFBX Probe Info |
![]() |
C716(0.00); C288(0.00) | LDD0148 | [3] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STS-1 Probe Info |
![]() |
N.A. | LDD0069 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0367 | CL1 | HEK-293T | C820(1.32) | LDD1571 | [5] |
| LDCM0370 | CL101 | HEK-293T | C820(1.15) | LDD1574 | [5] |
| LDCM0374 | CL105 | HEK-293T | C820(0.72) | LDD1578 | [5] |
| LDCM0378 | CL109 | HEK-293T | C820(1.00) | LDD1582 | [5] |
| LDCM0383 | CL113 | HEK-293T | C820(1.23) | LDD1587 | [5] |
| LDCM0387 | CL117 | HEK-293T | C820(1.83) | LDD1591 | [5] |
| LDCM0392 | CL121 | HEK-293T | C820(1.33) | LDD1596 | [5] |
| LDCM0396 | CL125 | HEK-293T | C820(1.53) | LDD1600 | [5] |
| LDCM0400 | CL13 | HEK-293T | C820(1.86) | LDD1604 | [5] |
| LDCM0413 | CL25 | HEK-293T | C820(1.12) | LDD1617 | [5] |
| LDCM0426 | CL37 | HEK-293T | C820(1.29) | LDD1630 | [5] |
| LDCM0439 | CL49 | HEK-293T | C820(1.75) | LDD1643 | [5] |
| LDCM0453 | CL61 | HEK-293T | C820(1.34) | LDD1656 | [5] |
| LDCM0466 | CL73 | HEK-293T | C820(1.69) | LDD1669 | [5] |
| LDCM0479 | CL85 | HEK-293T | C820(1.21) | LDD1682 | [5] |
| LDCM0492 | CL97 | HEK-293T | C820(1.44) | LDD1695 | [5] |
| LDCM0022 | KB02 | 42-MG-BA | C831(2.74); C820(2.54) | LDD2244 | [2] |
| LDCM0023 | KB03 | 42-MG-BA | C831(4.28) | LDD2661 | [2] |
| LDCM0024 | KB05 | COLO792 | C831(5.56); C716(3.71); C288(3.24) | LDD3310 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Epithelial discoidin domain-containing receptor 1 (DDR1) | Tyr protein kinase family | Q08345 | |||
| NT-3 growth factor receptor (NTRK3) | Tyr protein kinase family | Q16288 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Hsp90 co-chaperone Cdc37 (CDC37) | CDC37 family | Q16543 | |||
| Heat shock protein HSP 90-beta (HSP90AB1) | Heat shock protein 90 family | P08238 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Collagen alpha-2(XI) chain (COL11A2) | Fibrillar collagen family | P13942 | |||
The Drug(s) Related To This Target
Approved
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Fostamatinib | Small molecular drug | DB12010 | |||
| Imatinib | Small molecular drug | DB00619 | |||
| Regorafenib | Small molecular drug | DB08896 | |||
Patented
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Us9156852, 1 | Small molecular drug | D0CI3N | |||
| Us9156852, 105 | Small molecular drug | D0T8BO | |||
| Us9156852, 38 | Small molecular drug | D05AFD | |||
References




