Details of the Target
General Information of Target
| Target ID | LDTP06163 | |||||
|---|---|---|---|---|---|---|
| Target Name | Interleukin-13 receptor subunit alpha-2 (IL13RA2) | |||||
| Gene Name | IL13RA2 | |||||
| Gene ID | 3598 | |||||
| Synonyms |
IL13R; Interleukin-13 receptor subunit alpha-2; IL-13 receptor subunit alpha-2; IL-13R subunit alpha-2; IL-13R-alpha-2; IL-13RA2; Interleukin-13-binding protein; CD antigen CD213a2 |
|||||
| 3D Structure | ||||||
| Sequence |
MAFVCLAIGCLYTFLISTTFGCTSSSDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLD
HFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQ SSWAETTYWISPQGIPETKVQDMDCVYYNWQYLLCSWKPGIGVLLDTNYNLFYWYEGLDH ALQCVDYIKADGQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLP PVYLTFTRESSCEIKLKWSIPLGPIPARCFDYEIEIREDDTTLVTATVENETYTLKTTNE TRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEGEDLSKKTLLRFWLPFGFILILVIFVTG LLLRKPNTYPKMIPEFFCDT |
|||||
| Target Type |
Clinical trial
|
|||||
| Target Bioclass |
Cytokine and receptor
|
|||||
| Family |
Type I cytokine receptor family, Type 5 subfamily
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function | Binds as a monomer with high affinity to interleukin-13 (IL13), but not to interleukin-4 (IL4). | |||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
8.44 | LDD0402 | [1] | |
|
DBIA Probe Info |
![]() |
C197(6.02); C65(2.21); C378(2.29) | LDD3327 | [2] | |
|
EA-probe Probe Info |
![]() |
N.A. | LDD0440 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0175 | Ethacrynic acid | HeLa | N.A. | LDD0440 | [3] |
| LDCM0022 | KB02 | A101D | C252(0.99) | LDD2250 | [2] |
| LDCM0023 | KB03 | A-375 | C197(4.92); C269(2.94); C252(1.80); C378(4.03) | LDD2672 | [2] |
| LDCM0024 | KB05 | WM115 | C197(6.02); C65(2.21); C378(2.29) | LDD3327 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Galectin-3 (LGALS3) | . | P17931 | |||
Cytokine and receptor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Interleukin-13 (IL13) | IL-4/IL-13 family | P35225 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Insulin-like growth factor-binding protein 3 receptor (TMEM219) | . | Q86XT9 | |||
The Drug(s) Related To This Target
Phase 3
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Tralokinumab | Monoclonal antibody | D0I1ZY | |||
| Ict-107 | Vaccine | D0M1RD | |||
Phase 2
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Abt-308 | . | D0N3WN | |||
Phase 1
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Mb-101 | . | D0YN9Y | |||
Investigative
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Aer001 | . | DB05078 | |||
References



